Recombinant Full Length Staphylococcus Aureus Glycosyl-4,4'-Diaponeurosporenoate Acyltransferase(Crto) Protein, His-Tagged
Cat.No. : | RFL35732SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Glycosyl-4,4'-diaponeurosporenoate acyltransferase(crtO) Protein (Q2FV56) (29-165aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (29-165) |
Form : | Lyophilized powder |
AA Sequence : | GTRIPDKYFRQKYIIFKSFNFEKHGKFWNKWFYVRKWKHKILDGHQLNQNIYDQRHLMTI NTDEIEKMIIETKRAELIHWISILPVIIFNKGPRLVKYINIFYAMIANVPIIIVQRYNRP RLTQLLRILKRRGERHD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtO |
Synonyms | crtO; SAOUHSC_02882; Glycosyl-4,4'-diaponeurosporenoate acyltransferase |
UniProt ID | Q2FV56 |
◆ Recombinant Proteins | ||
SIGIRR-2422H | Recombinant Human SIGIRR protein, hFc-tagged | +Inquiry |
CX34.5-3302Z | Recombinant Zebrafish CX34.5 | +Inquiry |
Pf4-154R | Recombinant Rat Pf4 Protein, His/GST-tagged | +Inquiry |
RFL4695MF | Recombinant Full Length Mouse Vesicle-Trafficking Protein Sec22A(Sec22A) Protein, His-Tagged | +Inquiry |
ARG1-2553H | Recombinant Human ARG1 protein(21-90 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCRL1-2227HCL | Recombinant Human FCRL1 cell lysate | +Inquiry |
TNFRSF1B-851HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
ACPP-1625MCL | Recombinant Mouse ACPP cell lysate | +Inquiry |
COPS7A-384HCL | Recombinant Human COPS7A cell lysate | +Inquiry |
TRIM26-787HCL | Recombinant Human TRIM26 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All crtO Products
Required fields are marked with *
My Review for All crtO Products
Required fields are marked with *
0
Inquiry Basket