Recombinant Full Length Solanum Tuberosum Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged
Cat.No. : | RFL27579SF |
Product Overview : | Recombinant Full Length Solanum tuberosum Cytochrome b559 subunit alpha(psbE) Protein (Q2VEG1) (1-83aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum tuberosum (Potato) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-83) |
Form : | Lyophilized powder |
AA Sequence : | MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbE |
Synonyms | psbE; Cytochrome b559 subunit alpha; PSII reaction center subunit V |
UniProt ID | Q2VEG1 |
◆ Recombinant Proteins | ||
Kat2b-3644M | Recombinant Mouse Kat2b Protein, Myc/DDK-tagged | +Inquiry |
SLCO1B1-683C | Recombinant Cynomolgus Monkey SLCO1B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17069AF | Recombinant Full Length Angiopteris Evecta Nad(P)H-Quinone Oxidoreductase Subunit 6, Chloroplastic Protein, His-Tagged | +Inquiry |
CDT1-27915TH | Recombinant Human CDT1, His-tagged | +Inquiry |
SLC19A2-4546H | Recombinant Human SLC19A2 protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
KLH-82 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
GPT-26879TH | Native Human GPT | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT9B-284HCL | Recombinant Human WNT9B 293 Cell Lysate | +Inquiry |
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
SEZ6L2-865HCL | Recombinant Human SEZ6L2 cell lysate | +Inquiry |
RAB37-2602HCL | Recombinant Human RAB37 293 Cell Lysate | +Inquiry |
CYP4V2-440HCL | Recombinant Human CYP4V2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbE Products
Required fields are marked with *
My Review for All psbE Products
Required fields are marked with *
0
Inquiry Basket