Recombinant Full Length Solanum Tuberosum 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 2(Hmg2) Protein, His-Tagged
Cat.No. : | RFL11941SF |
Product Overview : | Recombinant Full Length Solanum tuberosum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2(HMG2) Protein (Q41437) (1-595aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum tuberosum (Potato) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-595) |
Form : | Lyophilized powder |
AA Sequence : | MDVRRRSEKPVYPSKVFGADEKPLKPHNNQQQEDNNTLLIDASDALPLPLYLTNGLFFTM FFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVSRGN NDSWDENDEEFLLKEDSRCGPATTLGCAIPAPPARQISPMAPPQPAMSMVEKPSPLITPA SSEEDEEIINSVVQGKFPSYSLVIQLGDVSAAASLRKEVMQRITGKSLEGLPLEGFTYES ILGQCCEMPIGYVQIPVGIAGPLLLNGKEFSVPMATTEGCLVASTNRGCKAIYASGGATC IVLRDGMTRAPCVRFGTAKRAAELKFFVEDPIKFETLANVFNQSSRFGRLQRIQCAIAGK NLYMRFVCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNWIEG RGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVSAVF IATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLNLLG VKGANREAPGSNARLLATVVAGSVLAGELSLMSAISAGQLVNSHMKYNRSTKASS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMG2 |
Synonyms | HMG2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2; HMG2.2 |
UniProt ID | Q41437 |
◆ Native Proteins | ||
Acylase-3P | Active Native Porcine Acylase | +Inquiry |
CSN-36H | Native Human COP9 signalosome Protein | +Inquiry |
Lectin-1820P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Fluorescein labeled | +Inquiry |
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRB2-130HCL | Recombinant Human ARRB2 cell lysate | +Inquiry |
IGHG4-842HCL | Recombinant Human IGHG4 cell lysate | +Inquiry |
PPP2R5D-2915HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
UMOD-1885HCL | Recombinant Human UMOD cell lysate | +Inquiry |
HDAC8-691HCL | Recombinant Human HDAC8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMG2 Products
Required fields are marked with *
My Review for All HMG2 Products
Required fields are marked with *
0
Inquiry Basket