Recombinant Full Length Solanum Lycopersicum Nad(P)H-Quinone Oxidoreductase Subunit 4L, Chloroplastic(Ndhe) Protein, His-Tagged
Cat.No. : | RFL10147SF |
Product Overview : | Recombinant Full Length Solanum lycopersicum NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic(ndhE) Protein (Q2MI48) (1-101aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-101) |
Form : | Lyophilized powder |
AA Sequence : | MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDNRQLKGD IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndhE |
Synonyms | ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L |
UniProt ID | Q2MI48 |
◆ Native Proteins | ||
C1q-04M | Native Mouse C1q Protein | +Inquiry |
MV-02 | Native Measles Virus Antigen | +Inquiry |
IL16-29736TH | Native Human IL16 | +Inquiry |
Ferrous Hemoglobin-033H | Native Human Ferrous Hemoglobin Protein | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTCHD3P1-4692HCL | Recombinant Human LOC387647 293 Cell Lysate | +Inquiry |
SAT2-2055HCL | Recombinant Human SAT2 293 Cell Lysate | +Inquiry |
HA-2816HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
GRAMD3-5760HCL | Recombinant Human GRAMD3 293 Cell Lysate | +Inquiry |
INF2-5209HCL | Recombinant Human INF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ndhE Products
Required fields are marked with *
My Review for All ndhE Products
Required fields are marked with *
0
Inquiry Basket