Recombinant Full Length Solanum Bulbocastanum Cytochrome B6-F Complex Subunit 4(Petd) Protein, His-Tagged
Cat.No. : | RFL26175SF |
Product Overview : | Recombinant Full Length Solanum bulbocastanum Cytochrome b6-f complex subunit 4(petD) Protein (Q2MIF7) (1-160aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum bulbocastanum (Wild potato) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-160) |
Form : | Lyophilized powder |
AA Sequence : | MGITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | petD |
Synonyms | petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide |
UniProt ID | Q2MIF7 |
◆ Recombinant Proteins | ||
SLC8A2B-6672Z | Recombinant Zebrafish SLC8A2B | +Inquiry |
IL17A-148H | Recombinant Active Human IL17A Protein, His-tagged(C-ter) | +Inquiry |
CLASP2-4082C | Recombinant Chicken CLASP2 | +Inquiry |
HDAC6-2056R | Recombinant Rhesus monkey HDAC6 Protein, His-tagged | +Inquiry |
DNAJC22-1292R | Recombinant Rhesus monkey DNAJC22 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Proteoglycans-52H | Native Human Proteoglycans | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
F2-5287M | Native Mouse Coagulation Factor II | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
LONP1-1423HCL | Recombinant Human LONP1 cell lysate | +Inquiry |
CALB1-7897HCL | Recombinant Human CALB1 293 Cell Lysate | +Inquiry |
MZB1-4338HCL | Recombinant Human MGC29506 293 Cell Lysate | +Inquiry |
TRIM54-768HCL | Recombinant Human TRIM54 293 Cell Lysate | +Inquiry |
AGR2-8972HCL | Recombinant Human AGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All petD Products
Required fields are marked with *
My Review for All petD Products
Required fields are marked with *
0
Inquiry Basket