Recombinant Full Length Sleeping Disease Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL18730SF |
Product Overview : | Recombinant Full Length Sleeping disease virus Structural polyprotein Protein (Q8QL52) (861-1322aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sleeping disease virus (SDV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (861-1322) |
Form : | Lyophilized powder |
AA Sequence : | YEHTVVVPMDPRAPSYEAVINRNGYDPLKLTIAVNFTVISPTTALEYWTCAGVPVVEPPH VGCCTSVSCPSDLSTLHAFTGKAVSDVHCDVHTNVYPLLWGAAHCFCSTENTQVSAVAAT VSEFCAQDSERAEAFSVHSSSVTAEILVTLGEVVTAVHVYVDGVTSARGTDLKIVAGPIT TDYSPFDRKVVRIGEEVYNYDWPPYGAGRPGTFGDIQARSTNYVKPNDLYGDIGIEVLQP TNDHVHVAYTYTTSGLLRWLQDAPKPLSVTAPHGCKISANPLLALDCGVGAVPMSINIPD AKFTRKLKDPKPSALKCVVDSCEYGVDYGGAATITYEGHEAGKCGIHSLTPGVPLRTSVV EVVAGANTVKTTFSSPTPEVTLEVEICSAIVKCASECTPPKEHVVAARPRHGSDTGGYIS GPAMRWAGRIVGNPSGPVSSSLAVTYCVVKKCRSKRIRIVKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sleeping disease virus Structural polyprotein |
Synonyms | Structural polyprotein; p130 |
UniProt ID | Q8QL52 |
◆ Recombinant Proteins | ||
WNT7A-278H | Recombinant Human wingless-type MMTV integration site family, member 7A, His-tagged | +Inquiry |
Fbln7-228R | Recombinant Rat Fbln7 Protein, His-tagged | +Inquiry |
NME2-3055R | Recombinant Rhesus monkey NME2 Protein, His-tagged | +Inquiry |
HSDL2-13968H | Recombinant Human HSDL2, His-tagged | +Inquiry |
S-097S | Recombinant SARS-CoV-2 Spike RBD (F456L) Mutant Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA242-161H | Active Native Human Cancer Antigen 242 | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
CP-26450TH | Native Human CP | +Inquiry |
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXorf40A-7156HCL | Recombinant Human CXorf40A 293 Cell Lysate | +Inquiry |
IL22RA1-768CCL | Recombinant Canine IL22RA1 cell lysate | +Inquiry |
ARHGEF2-8732HCL | Recombinant Human ARHGEF2 293 Cell Lysate | +Inquiry |
MAPT-4478HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
UEVLD-523HCL | Recombinant Human UEVLD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Sleeping disease virus Structural polyprotein Products
Required fields are marked with *
My Review for All Sleeping disease virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket