Recombinant Full Length Silicibacter Sp. Cobalamin Biosynthesis Protein Cobd(Cobd) Protein, His-Tagged
Cat.No. : | RFL16170RF |
Product Overview : | Recombinant Full Length Silicibacter sp. Cobalamin biosynthesis protein CobD(cobD) Protein (Q1GDE9) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ruegeria sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MSTAALLIPAMILDAAFGEPKWLWSRLPHPAVLMGKLVQALDDRLNEGDGRQVKGVIAVA VLVFVGLLLGWILSWFGSLVSVLIAAILIAQRSLIDHVRAVATGLQNDLDAGRSAVAMIV SRDTATMTGPQIARSAIESGAENFSDGVIAPAFWFLVAGLPGLLIYKLINTADSMIGYRT EAYEDFGWAAARLDDVLNILPARLSALLIALVTGRAGDWGEISADARKHRSPNAGWPEAA MARALGVALAGPRSYDGEMRPFAWVNASGSKSASAHSITRCCEVLWKSWGLALVLVVALG LLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cobD |
Synonyms | cobD; TM1040_2585; Cobalamin biosynthesis protein CobD |
UniProt ID | Q1GDE9 |
◆ Recombinant Proteins | ||
ZNF740-10468M | Recombinant Mouse ZNF740 Protein, His (Fc)-Avi-tagged | +Inquiry |
TPSG1-4739R | Recombinant Rhesus Macaque TPSG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERBB2-894H | Recombinant Human V-Erb-B2 Erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/Glioblastoma Derived Oncogene Homolog (avian), Methionine | +Inquiry |
GSTA2-1666HFL | Recombinant Full Length Human GSTA2 Protein, C-Flag-tagged | +Inquiry |
SYPL2-16323M | Recombinant Mouse SYPL2 Protein | +Inquiry |
◆ Native Proteins | ||
SERPINA3-5331H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 3 | +Inquiry |
PTI-1900B | Native Bovine Pancreatic Trypsin Inhibitor | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
FGA-58R | Native Rabbit Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPOR & CD131-1943HCL | Recombinant Human EPOR & CD131 cell lysate | +Inquiry |
TMEM120A-1011HCL | Recombinant Human TMEM120A 293 Cell Lysate | +Inquiry |
RPS19-2169HCL | Recombinant Human RPS19 293 Cell Lysate | +Inquiry |
SERTAD3-1933HCL | Recombinant Human SERTAD3 293 Cell Lysate | +Inquiry |
TDP1-1155HCL | Recombinant Human TDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cobD Products
Required fields are marked with *
My Review for All cobD Products
Required fields are marked with *
0
Inquiry Basket