Recombinant Full Length Silene Pratensis Chlorophyll A-B Binding Protein, Chloroplastic Protein, His-Tagged
Cat.No. : | RFL30959SF |
Product Overview : | Recombinant Full Length Silene pratensis Chlorophyll a-b binding protein, chloroplastic Protein (P12332) (37-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Silene latifolia subsp. alba (White campion) (Lychnis alba) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (37-205) |
Form : | Lyophilized powder |
AA Sequence : | RRTIKSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNREL EVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSI LAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPEAF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Silene pratensis Chlorophyll a-b binding protein, chloroplastic |
Synonyms | Chlorophyll a-b binding protein, chloroplastic; LHCII type I CAB; LHCP; Fragment |
UniProt ID | P12332 |
◆ Recombinant Proteins | ||
PCOLCEA-3288Z | Recombinant Zebrafish PCOLCEA | +Inquiry |
CYP2D17-188C | Recombinant Cynomolgus Monkey CYP2D17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ifngr1-5687M | Recombinant Mouse Ifngr1 Protein (Ala26-Asp253), C-Fc tagged | +Inquiry |
BTR16-4544Z | Recombinant Zebrafish BTR16 | +Inquiry |
PPIB-4260R | Recombinant Rat PPIB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
APOA1-8344H | Native Human APOA1 | +Inquiry |
GALM-40P | Active Native Porcine Mutarotase | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
Ferrous Hemoglobin-032B | Native Bovine Ferrous Hemoglobin Protein | +Inquiry |
vip3A-38B | Native Bacillus thuringiensis vip3A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALK2-6042HCL | Recombinant Human GALK2 293 Cell Lysate | +Inquiry |
SYT16-1307HCL | Recombinant Human SYT16 293 Cell Lysate | +Inquiry |
GSTM1-5713HCL | Recombinant Human GSTM1 293 Cell Lysate | +Inquiry |
ZBED5-1950HCL | Recombinant Human ZBED5 cell lysate | +Inquiry |
G3BP2-6084HCL | Recombinant Human G3BP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Silene pratensis Chlorophyll a-b binding protein, chloroplastic Products
Required fields are marked with *
My Review for All Silene pratensis Chlorophyll a-b binding protein, chloroplastic Products
Required fields are marked with *
0
Inquiry Basket