Recombinant Full Length Shigella Sonnei Spermidine Export Protein Mdti(Mdti) Protein, His-Tagged
Cat.No. : | RFL24270SF |
Product Overview : | Recombinant Full Length Shigella sonnei Spermidine export protein MdtI(mdtI) Protein (Q3Z1V2) (1-109aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella sonnei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-109) |
Form : | Lyophilized powder |
AA Sequence : | MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mdtI |
Synonyms | mdtI; SSON_1561; Spermidine export protein MdtI |
UniProt ID | Q3Z1V2 |
◆ Recombinant Proteins | ||
PFAG_00946-5723P | Recombinant Plasmodium falciparum Santa Lucia PFAG_00946 Protein (Asn1183-Met1481), C-His tagged | +Inquiry |
Cbln3-2471M | Recombinant Mouse Cbln3 protein, His-SUMO-tagged | +Inquiry |
CYGB1-9419Z | Recombinant Zebrafish CYGB1 | +Inquiry |
RFL16222EF | Recombinant Full Length V-Type Sodium Atpase Subunit K(Ntpk) Protein, His-Tagged | +Inquiry |
CSNK1D-2191HF | Recombinant Full Length Human CSNK1D Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C5a-12H | Active Native Human C5a Anaphylatoxin Protein | +Inquiry |
Immunoglobulin G2-82H | Native Human Immunoglobulin G2 | +Inquiry |
LTF-175H | Native Human lactoferrin | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL35-4176HCL | Recombinant Human MRPL35 293 Cell Lysate | +Inquiry |
HNRNPA1L2-5451HCL | Recombinant Human HNRNPA1L2 293 Cell Lysate | +Inquiry |
THAP3-1772HCL | Recombinant Human THAP3 cell lysate | +Inquiry |
RBP4-1045CCL | Recombinant Cynomolgus RBP4 cell lysate | +Inquiry |
C12orf23-8328HCL | Recombinant Human C12orf23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mdtI Products
Required fields are marked with *
My Review for All mdtI Products
Required fields are marked with *
0
Inquiry Basket