Recombinant Full Length Shigella Dysenteriae Serotype 1 Thiol:Disulfide Interchange Protein Dsbd(Dsbd) Protein, His-Tagged
Cat.No. : | RFL26593SF |
Product Overview : | Recombinant Full Length Shigella dysenteriae serotype 1 Thiol:disulfide interchange protein DsbD(dsbD) Protein (Q328D2) (20-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella Dysenteriae Serotype 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-565) |
Form : | Lyophilized powder |
AA Sequence : | GLFDAPGRSQFVPADQAFTFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNAAPQPVSVPQQEQPTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPVFLLER VIGDIWGLRLWSALGVAFFGGAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKEFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dsbD |
Synonyms | dsbD; SDY_4441; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase |
UniProt ID | Q328D2 |
◆ Recombinant Proteins | ||
GLMS-0333B | Recombinant Bacillus subtilis GLMS protein, His-tagged | +Inquiry |
PHAX-4076R | Recombinant Rat PHAX Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL22-311H | Recombinant Human CCL22 Protein, His-tagged | +Inquiry |
ERI2-5301M | Recombinant Mouse ERI2 Protein | +Inquiry |
MHC2DAB-9036Z | Recombinant Zebrafish MHC2DAB | +Inquiry |
◆ Native Proteins | ||
Lectin-1816P | Active Native Peanut Lectin Protein, Fluorescein labeled | +Inquiry |
Collagen Type I-48H | Native Human tendon collagen type I | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKL-3272HCL | Recombinant Human PFKL 293 Cell Lysate | +Inquiry |
MET-1054RCL | Recombinant Rat MET cell lysate | +Inquiry |
FZD4-1196RCL | Recombinant Rat FZD4 cell lysate | +Inquiry |
CD24-1422MCL | Recombinant Mouse CD24 cell lysate | +Inquiry |
BTBD8-191HCL | Recombinant Human BTBD8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All dsbD Products
Required fields are marked with *
My Review for All dsbD Products
Required fields are marked with *
0
Inquiry Basket