Recombinant Full Length Shewanella Oneidensis Upf0283 Membrane Protein So_1811(So_1811) Protein, His-Tagged
Cat.No. : | RFL15450SF |
Product Overview : | Recombinant Full Length Shewanella oneidensis UPF0283 membrane protein SO_1811(SO_1811) Protein (Q8EG03) (1-401aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella oneidensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-401) |
Form : | Lyophilized powder |
AA Sequence : | MSVELLPHSTEPHANGADKSVSAAARVTQSLKKQQVFDAEQVKLQSATDELKSAQMFAPQ TPITAIDDVVDEALAAHPQALDVESIRPKLHQSRRWSWLARLSLMALLLLTLVQTVLGLR DAWLESPWLFSFYGAVLGIVGSWAIVGVIGEYRKLKRLKQVADTQETGARLALSMQMGEA DGFIDNIVRHYPDSQGLQRLRHSLKDEHNDAEKVLLFEDLVLTERDELAKKIVRRYAAES AVLLAASPLAVLDMAIILWRNQRMLRDVAACYGIELGYWSRIKLIRSIVINIIYAGTSEL VTDLGTQLLSVEMTGKLSARLAQGLGGGLLTARLGYQAMALCRPIRFKDEQRPKLTKVHQ ELLMELKQFAGNLLTKDGRDALKTQLEGTEVNTSSKEKSLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SO_1811 |
Synonyms | SO_1811; UPF0283 membrane protein SO_1811 |
UniProt ID | Q8EG03 |
◆ Recombinant Proteins | ||
IL10RA-4323H | Recombinant Human IL10RA protein, His&Myc-tagged | +Inquiry |
TATCD-0264B | Recombinant Bacillus subtilis TATCD protein, His-tagged | +Inquiry |
MEA1-3632R | Recombinant Rat MEA1 Protein | +Inquiry |
RFL23649BF | Recombinant Full Length Berne Virus Membrane Protein(M) Protein, His-Tagged | +Inquiry |
PEDINA-P06-4595S | Recombinant Staphylococcus aureus (strain: E-1) PEDINA_P06 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1859W | Active Native Wheat Germ Agglutinin Protein, Agarose bound | +Inquiry |
F5-29S | Native Snake Russells Viper Venom Factor V Activator | +Inquiry |
TOD-43 | Active Native Tyramine Oxidase | +Inquiry |
KLH-83 | Native Hemocyanin-Keyhole Limpet (KLH) subunits | +Inquiry |
IgG-354G | Native Guinea Pig IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKX2-3813HCL | Recombinant Human NKX2 293 Cell Lysate | +Inquiry |
ZGPAT-169HCL | Recombinant Human ZGPAT 293 Cell Lysate | +Inquiry |
RALGPS2-1466HCL | Recombinant Human RALGPS2 cell lysate | +Inquiry |
LINC00303-8176HCL | Recombinant Human C1orf157 293 Cell Lysate | +Inquiry |
ODF4-3594HCL | Recombinant Human ODF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SO_1811 Products
Required fields are marked with *
My Review for All SO_1811 Products
Required fields are marked with *
0
Inquiry Basket