Recombinant Full Length Shewanella Baltica Upf0761 Membrane Protein Sbal195_0319 (Sbal195_0319) Protein, His-Tagged
Cat.No. : | RFL3622SF |
Product Overview : | Recombinant Full Length Shewanella baltica UPF0761 membrane protein Sbal195_0319 (Sbal195_0319) Protein (A9KXA4) (1-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella baltica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-323) |
Form : | Lyophilized powder |
AA Sequence : | MTKKIELAQIRVLFLGIWHFLLHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLS AFPVFKGIRGQIEGFVYENFLPAAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISA IDKSLNNIWRTKEKRSVVVAFSMYWMVLTLGPVLVGASLVASSYVISLKVFEAEALSGML PIFIARLPMLFSVAAFLLLYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPS YEAIYGALATIPIVFVWVYLSWMIVLLGAEITAAMPEYLDYESSSDDETALNAKPLADAS QGDSSSVLTSAEVTALKAVAKSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sbal195_0319 |
Synonyms | Sbal195_0319; UPF0761 membrane protein Sbal195_0319 |
UniProt ID | A9KXA4 |
◆ Native Proteins | ||
Neuraminidase-006C | Active Native Clostridium perfringens Neuraminidase, Type VI | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
PGN-17S | Native S. aureus PGN Protein | +Inquiry |
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCOLN1-4414HCL | Recombinant Human MCOLN1 293 Cell Lysate | +Inquiry |
PHLDA1-3221HCL | Recombinant Human PHLDA1 293 Cell Lysate | +Inquiry |
BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
DEFA1-6991HCL | Recombinant Human DEFA1 293 Cell Lysate | +Inquiry |
SEMA4D-1298RCL | Recombinant Rat SEMA4D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Sbal195_0319 Products
Required fields are marked with *
My Review for All Sbal195_0319 Products
Required fields are marked with *
0
Inquiry Basket