Recombinant Full Length Shewanella Baltica Upf0761 Membrane Protein Sbal_0315 (Sbal_0315) Protein, His-Tagged
Cat.No. : | RFL18419SF |
Product Overview : | Recombinant Full Length Shewanella baltica UPF0761 membrane protein Sbal_0315 (Sbal_0315) Protein (A3CZD5) (1-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella baltica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-323) |
Form : | Lyophilized powder |
AA Sequence : | MTKKIELAQIRVLFLGIWHFLLHLRRRLVEDQINIRAGHLAYVTLLSLVPMVAVTMSMLS AFPVFKGIRGQIEGFVYENFLPAAGDTVQVYINEFVGNASKGTAVGIAALVVVAIMLISA IDKSLNNIWRTKEKRSVVVAFSMYWMVLTLGPVLVGASLVASSYVISLKVFEAEALSGML PIFIARLPMLFSVAAFLLLYMVVPNQKVKFLHALLGAIVAALLFELGKKGFALYVTQFPS YEAIYGALATIPIVFVWVYLSWMIVLLGAEITAAMPEYLDYESSSDDETALNAKPLADAS QGDSSSVLTSAEVTALKAVAKSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sbal_0315 |
Synonyms | Sbal_0315; UPF0761 membrane protein Sbal_0315 |
UniProt ID | A3CZD5 |
◆ Recombinant Proteins | ||
BLAZ-2326S | Recombinant Staphylococcus aureus (strain: VET A6-001648, other: mec type IVh) BLAZ protein, His-tagged | +Inquiry |
LTC4S-923H | Recombinant Human LTC4S protein(Met1-Ala150), His-tagged | +Inquiry |
UGT2A2-4263H | Recombinant Human UGT2A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LARS-8208H | Recombinant Human LARS protein, His & T7-tagged | +Inquiry |
SPACA3-2892H | Recombinant Human SPACA3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
NADS-33 | Active Native NAD synthase | +Inquiry |
Lectin-1809M | Active Native Maackia Amurensis Lectin II Protein, Biotinylated | +Inquiry |
Lectin-1756C | Active Native Canavalia ensiformis Concanavalin A Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTTP-4064HCL | Recombinant Human MTTP 293 Cell Lysate | +Inquiry |
BIRC7-8447HCL | Recombinant Human BIRC7 293 Cell Lysate | +Inquiry |
HUS1-5327HCL | Recombinant Human HUS1 293 Cell Lysate | +Inquiry |
Fetal Thymus-173H | Human Fetal Thymus Lysate | +Inquiry |
TBRG4-1206HCL | Recombinant Human TBRG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Sbal_0315 Products
Required fields are marked with *
My Review for All Sbal_0315 Products
Required fields are marked with *
0
Inquiry Basket