Recombinant Full Length Sheep Prostaglandin F2-Alpha Receptor(Ptgfr) Protein, His-Tagged
Cat.No. : | RFL17700OF |
Product Overview : | Recombinant Full Length Sheep Prostaglandin F2-alpha receptor(PTGFR) Protein (Q28905) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MSTNNSVQPVSPASELLSNTTCQLEEDLSISFSIIFMTVGILSNSLAIAILMKAYQRFRQ KYKSSFLLLASALVITDFFGHLINGTIAVFVYASDKDWIYFDKSNILCSIFGICMVFSGL CPLFLGSLMAIERCIGVTKPIFHSTKITTKHVKMMLSGVCFFAVFVALLPILGHRDYKIQ ASRTWCFYKTDQIKDWEDRFYLLLFAFLGLLALGISFVCNAITGISLLKVKFRSQQHRQG RSHHFEMVIQLLGIMCVSCICWSPFLVTMASIGMNIQDFKDSCERTLFTLRMATWNQILD PWVYILLRKAVLRNLYVCTRRCCGVHVISLHVWELSSIKNSLKVAAISDLPVTEKVTQQT ST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTGFR |
Synonyms | PTGFR; Prostaglandin F2-alpha receptor; PGF receptor; PGF2-alpha receptor; Prostanoid FP receptor |
UniProt ID | Q28905 |
◆ Recombinant Proteins | ||
PTGFR-4469R | Recombinant Rat PTGFR Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL34192MF | Recombinant Full Length Mouse Prostaglandin F2-Alpha Receptor(Ptgfr) Protein, His-Tagged | +Inquiry |
PTGFR-7757Z | Recombinant Zebrafish PTGFR | +Inquiry |
RFL22255BF | Recombinant Full Length Bovine Prostaglandin F2-Alpha Receptor(Ptgfr) Protein, His-Tagged | +Inquiry |
PTGFR-13644M | Recombinant Mouse PTGFR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTGFR-2711HCL | Recombinant Human PTGFR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTGFR Products
Required fields are marked with *
My Review for All PTGFR Products
Required fields are marked with *
0
Inquiry Basket