Recombinant Full Length Serpentine Receptor Class Gamma-69(Srg-69) Protein, His-Tagged
Cat.No. : | RFL25985CF |
Product Overview : | Recombinant Full Length Serpentine receptor class gamma-69(srg-69) Protein (Q19258) (1-342aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-342) |
Form : | Lyophilized powder |
AA Sequence : | MNSCHPPQDEMAGLIGIYAFQGFYGLLSVVVYTFNIRALRHHKNNLDKSFSLLYTCCAAL SLTYFLDHFLIRRFVKLGFFCEIILENFGEPNYWMMPYKTIASYCPIAILVFHALIAAHR FSIVAAPMRGVQLWDRYRRLFVLVGFLIPLIFMWFMIPCKSYAELDSEGSGGLDIEYKKV FSISSSLAAAIAAVLFGVLTLCLTFGMLIALAKLSLRKLSQAEISLIVFEVFMTVFTLIY AFTQGILYYSIYIVKDMELKSTVIQFRTFAIDIFILPQAWTLLFLSTTVRRYTLRAFGKR LGVEFLSTEIEKSARMVSVAPATISLQKSTVLNYNFTLQNLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srg-69 |
Synonyms | srg-69; F09E5.4; Serpentine receptor class gamma-69; Protein srg-69 |
UniProt ID | Q19258 |
◆ Recombinant Proteins | ||
GSN-530H | Recombinant Human GSN Protein, His/GST-tagged | +Inquiry |
NOG2-3400C | Recombinant Chicken NOG2 | +Inquiry |
JDP2-2795R | Recombinant Rat JDP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GDF2-0775H | Recombinant Human GDF2 Protein (Ser320-Arg429), C-His tagged | +Inquiry |
Nutf2-4560M | Recombinant Mouse Nutf2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
KRT18-173B | Native bovine KRT18 | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
H3N20194-213I | Native H3N2 (A/Kiev/301/94) H3N20194 protein | +Inquiry |
C4BPA-100H | Native Human C4a Anaphylatoxin (Not Recombinant) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEK293-154H | 293 Whole Cell Lysate | +Inquiry |
KG-1-050HCL | Human KG-1 Whole Cell Lysate | +Inquiry |
TOP3B-1810HCL | Recombinant Human TOP3B cell lysate | +Inquiry |
IFI30-1503HCL | Recombinant Human IFI30 cell lysate | +Inquiry |
PCNP-3376HCL | Recombinant Human PCNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All srg-69 Products
Required fields are marked with *
My Review for All srg-69 Products
Required fields are marked with *
0
Inquiry Basket