Recombinant Full Length Serpentine Receptor Class Gamma-3(Srg-3) Protein, His-Tagged
Cat.No. : | RFL16210CF |
Product Overview : | Recombinant Full Length Serpentine receptor class gamma-3(srg-3) Protein (P46572) (1-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-332) |
Form : | Lyophilized powder |
AA Sequence : | MSYEHCISGYTNFNENIHYFYQFAYLFTAICINYRILYVIWVSQRHFYRNQSFYNLYSVD CFTSVLAMSNELIFTRSFLYFPQLCVSFSEIVKNSPVFMRIYYCLLSYLIAIKPVIHIFI AVNRMSCVMFPVTYSQNWSQKLRIMLIVIFLAPFLVIWNVLISDNFIGYVNGGFGISYTR RVTWASLSLMQFTLIILTVLITMVTTTVTFYKMTTMKKRIKASERALCIAAALISVGFLL EAITQSFFAFFKEAPWLLDVMNYLRFATMDILFVGSPLVLLLVSDQFRGHVLGSRIGRTQ RVSSINNTHSHIHHNTHHTMTRYSYFLWNVNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srg-3 |
Synonyms | srg-3; C18F10.6; Serpentine receptor class gamma-3; Protein srg-3 |
UniProt ID | P46572 |
◆ Native Proteins | ||
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
IgG-019R | Native Rat Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST6GAL1-1919HCL | Recombinant Human ST6GAL1 cell lysate | +Inquiry |
ZNF473-2033HCL | Recombinant Human ZNF473 cell lysate | +Inquiry |
CHN1-002HCL | Recombinant Human CHN1 cell lysate | +Inquiry |
KBTBD6-889HCL | Recombinant Human KBTBD6 cell lysate | +Inquiry |
ARAP1-337HCL | Recombinant Human ARAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srg-3 Products
Required fields are marked with *
My Review for All srg-3 Products
Required fields are marked with *
0
Inquiry Basket