Recombinant Full Length Serpentine Receptor Class Gamma-17(Srg-17) Protein, His-Tagged
Cat.No. : | RFL12211CF |
Product Overview : | Recombinant Full Length Serpentine receptor class gamma-17(srg-17) Protein (O17820) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MGTTNLTLDSESICDPNYDILFENAIYFVTACYLSVGLFCHISLLKIILISDRKYFKDNS FFVLFRADLFASTTLLLYDIFFGRIFMYIPQLCPFVSTFFSTPTIFLKVLYVAQNHARFV KSLSQIFMVLNRMSCVLMPATYNQFWNKITPIASFIMLILPFAGLWNIMISQVIASSVRG GFGVDYIKAVKWASLSLFQSICILTALGFTIVCTSVTFYKLACLSDRVRSIERSLCFTSI SISCTFLLVAGTQLTFATCASCKTDAMYILQFLAFDTFNVGSAIIMFLTNRHLRSSMFSS QKKRAVTVVTVGQISTNTYN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srg-17 |
Synonyms | srg-17; F15A4.7; Serpentine receptor class gamma-17; Protein srg-17 |
UniProt ID | O17820 |
◆ Native Proteins | ||
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
Lysostaphin-91S | Active Native Staphylococcus staphylolyticus Lysostaphin | +Inquiry |
C4A-2H | Native Human Complement C4 | +Inquiry |
Ubiquitin-001 | Biotinylated Ubiquitin | +Inquiry |
Collagen-01B | Native Bovine Type II Collagen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC33A1-1629HCL | Recombinant Human SLC33A1 cell lysate | +Inquiry |
NARS2-3967HCL | Recombinant Human NARS2 293 Cell Lysate | +Inquiry |
ZNF691-26HCL | Recombinant Human ZNF691 293 Cell Lysate | +Inquiry |
ATP5C1-8604HCL | Recombinant Human ATP5C1 293 Cell Lysate | +Inquiry |
TCERG1-1184HCL | Recombinant Human TCERG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All srg-17 Products
Required fields are marked with *
My Review for All srg-17 Products
Required fields are marked with *
0
Inquiry Basket