Recombinant Full Length Serpentine Receptor Class Gamma-15(Srg-15) Protein, His-Tagged
Cat.No. : | RFL26775CF |
Product Overview : | Recombinant Full Length Serpentine receptor class gamma-15(srg-15) Protein (Q18428) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MTTNYSEPDPLVCDETYSSSIEILKYLLTISYLIPGGILHLFILHTILVTRRGYFKGSSF FAIFALDSVSSIIIVFIDSFYGRLFLYVPPLCPIVGPFFWASSLIPKIYFYLSVHTRLSK CVAHICMVLNRMTCVLMPTYYGQIWRKLTKVSLVIICILPLGGTWNIIISPRFYVLPSYG GFAISYVRAIPWASSSLFQSIYILTALVFTFICTSVTLYKLISLSDRIKSAEKSLCFSNI YISLTFLAAAASQALYAFCTSCMSSDLLFTAQFLAFDMFTVGSAVILFWSNSQIRGLILP SKAEDDRIFRVQTINNSFTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srg-15 |
Synonyms | srg-15; C34C6.1; Serpentine receptor class gamma-15; Protein srg-15 |
UniProt ID | Q18428 |
◆ Recombinant Proteins | ||
TGIF2LX-4505R | Recombinant Rhesus Macaque TGIF2LX Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS2-1189R | Recombinant Rat COPS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nfkb2-1851M | Recombinant Mouse Nfkb2 protein, His & T7-tagged | +Inquiry |
NADD-1246S | Recombinant Streptomyces coelicolor A3(2) NADD protein, His-tagged | +Inquiry |
GOLGA2-01H | Recombinant Human GOLGA2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Cs-164P | Active Native Porcine Citrate Synthase | +Inquiry |
H3N2-03I | Active Native IAV H3N2 Protein | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
MYS-01R | Active Native Rabbit Heavy Meromyosin Protein | +Inquiry |
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZCWPW1-1967HCL | Recombinant Human ZCWPW1 cell lysate | +Inquiry |
UFM1-519HCL | Recombinant Human UFM1 293 Cell Lysate | +Inquiry |
GGT5-702HCL | Recombinant Human GGT5 cell lysate | +Inquiry |
TAL1-1259HCL | Recombinant Human TAL1 293 Cell Lysate | +Inquiry |
RNF34-2279HCL | Recombinant Human RNF34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srg-15 Products
Required fields are marked with *
My Review for All srg-15 Products
Required fields are marked with *
0
Inquiry Basket