Recombinant Full Length Serpentine Receptor Class Delta-2(Srd-2) Protein, His-Tagged
Cat.No. : | RFL13969CF |
Product Overview : | Recombinant Full Length Serpentine receptor class delta-2(srd-2) Protein (Q21767) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MNNTIQNSTITDDLKYVMTLDKLTEYLSCLICLPGALCNAILIYLIWKRTPIQMRSYAIY ILNFALFDFATCIISFFSCQQVIFSDFSLVYIFHGPCKYVSPWFCYFCHCFMCHALAHSQ WILLGSFIYRYRVLTGETPTAKDLIRNSVALYSMSLCFLLVYVFDNSDSDLLFQILTRVH PEYHYDDESIWKKSIVVSGNISAFAPITLISILYMTIPCVPIYCAILYFRHNTRVILNNP HINLSPTAKSNHVKLIRALTVQAGIPIFWLVASGIFTMSQFGIIGGPIPENITFRLMDCI PLISPIVTIIFVQPYREGLLKVLLKNSGLFVPNIIGSSIVDQTVAVTSVFGPKVTAFVQT QL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srd-2 |
Synonyms | srd-2; R05H5.1; Serpentine receptor class delta-2; Protein srd-2 |
UniProt ID | Q21767 |
◆ Recombinant Proteins | ||
PBANKA_093100-2411 | Recombinant PBANKA_093100 protein, His-tagged | +Inquiry |
ACVRL1-090H | Recombinant Human ACVRL1 Protein, His-tagged | +Inquiry |
HEPACAM2-4124M | Recombinant Mouse HEPACAM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT9-4947M | Recombinant Mouse KRT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT19-1659C | Recombinant Canine KRT19 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PKLR-244R | Active Native Rabbit Pyruvate Kinase | +Inquiry |
MB-4460H | Native Human Myoglobin | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
DENV2-01DCL | Native DENV2 Lysate | +Inquiry |
TF-172S | Native Sheep transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Hepa-779M | Hepa(mouse hepatoma) whole cell lysate | +Inquiry |
ATP6V1H-8573HCL | Recombinant Human ATP6V1H 293 Cell Lysate | +Inquiry |
FAM127A-6434HCL | Recombinant Human FAM127A 293 Cell Lysate | +Inquiry |
AARSD1-9156HCL | Recombinant Human AARSD1 293 Cell Lysate | +Inquiry |
CLCF1-001HCL | Recombinant Human CLCF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srd-2 Products
Required fields are marked with *
My Review for All srd-2 Products
Required fields are marked with *
0
Inquiry Basket