Recombinant Full Length Serpentine Receptor Class Beta-5(Srb-5) Protein, His-Tagged
Cat.No. : | RFL25033CF |
Product Overview : | Recombinant Full Length Serpentine receptor class beta-5(srb-5) Protein (Q95ZY4) (1-345aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-345) |
Form : | Lyophilized powder |
AA Sequence : | MAEINQTKCDLAFQISYHPIYRLAQFWTLSVSLLAVPSLLYFLLKRVLLLPFHGNLKCLL ITYFSSIFLYALVLCFDFSYQCLIPFIVTTKCSLIIDQTLYKCGHMTSLFFLTTPMLLPF GFSIERFVAVGMAYKYEKMRTLLGPILCFILVAPNFVVFYFLFRDEQFTDSFISFLVLPN TPAVQFNNYLWFLLYAKIGNFCCNCVLLIFHKRFKNTYLKKKTSLSVRYALEEISNSSKF TLILTFTHLVFFGAYTIGSILVRTLGESFFGNFLNFYVARGVNCAVPTYNLLIAFVGLIS LRQLNSRRHAKILTKVLIRVTGQEGARNYDDIIMQQWNTVSNRTR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srb-5 |
Synonyms | srb-5; C27D6.6; Serpentine receptor class beta-5; Protein srb-5 |
UniProt ID | Q95ZY4 |
◆ Recombinant Proteins | ||
LSS-5421Z | Recombinant Zebrafish LSS | +Inquiry |
TINF2-4976Z | Recombinant Zebrafish TINF2 | +Inquiry |
DEUP1-0570H | Recombinant Human DEUP1 Protein, GST-Tagged | +Inquiry |
SNRPD1-4379R | Recombinant Rhesus monkey SNRPD1 Protein, His-tagged | +Inquiry |
RFL34600WF | Recombinant Full Length Welwitschia Mirabilis Envelope Membrane Protein, Chloroplastic(Cema) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Hyaluronidase-34O | Active Native Ovine Hyaluronidase | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
Alb-7992M | Native Mouse Serum Albumin | +Inquiry |
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFIP1-8752HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry |
GABRG2-6057HCL | Recombinant Human GABRG2 293 Cell Lysate | +Inquiry |
CDH6-2727HCL | Recombinant Human CDH6 cell lysate | +Inquiry |
SRM-1479HCL | Recombinant Human SRM 293 Cell Lysate | +Inquiry |
ELK4-6627HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All srb-5 Products
Required fields are marked with *
My Review for All srb-5 Products
Required fields are marked with *
0
Inquiry Basket