Recombinant Full Length Serpentine Receptor Class Beta-15(Srb-15) Protein, His-Tagged
Cat.No. : | RFL14985CF |
Product Overview : | Recombinant Full Length Serpentine receptor class beta-15(srb-15) Protein (O01509) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MTEISEICETAFKLTYHPIYRGSLFIHLFVSISSIIPLIYFVIFKLPKTSFHGNLKFLFS AYFVSVFLFSVDFAIISTTEILIPLFSKHPCNLLIPDQYLKIGNTTVSIFMSLSTFFPIS ITIERFIAMKMARTYEKTRVRLGPILTGCNILLDLLIVFFIYRDEKFDDGSISFVFFPKT LAPKMFTFFWVMFFLNLINFTFNSYLLRQSIRLKVSTSSLATKYQREEVVHSTKFAVFVV FCHVILFGFYVIGIMILRYFGSIFIPDPADLMATRGAFTTMISLYNLVVGSVAVYLNHLI KTRKSEEITGTVRIQATGAVGAQNYENAIFNIWNSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | srb-15 |
Synonyms | srb-15; C48B6.5; Serpentine receptor class beta-15; Protein srb-15 |
UniProt ID | O01509 |
◆ Recombinant Proteins | ||
VAV1-23H | Recombinant Human VAV1 Protein, Aa168-522, Y174D Mutant, N-6×His tagged | +Inquiry |
Usp2-106M | Recombinant Mouse Usp2 Protein, His-tagged | +Inquiry |
SNX17-4188Z | Recombinant Zebrafish SNX17 | +Inquiry |
CDC40-1549C | Recombinant Chicken CDC40 | +Inquiry |
KIR3DL2-4344H | Recombinant Human KIR3DL2 Protein (Met1-His340), C-His tagged | +Inquiry |
◆ Native Proteins | ||
ALB-8301S | Native Sheep ALB | +Inquiry |
C5-10540H | Active Native Human C5 | +Inquiry |
PSA-01H | Native Human PSA-ACT Complex Protein | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF114-2306HCL | Recombinant Human RNF114 293 Cell Lysate | +Inquiry |
SERPINB13-1939HCL | Recombinant Human SERPINB13 293 Cell Lysate | +Inquiry |
Cerebrum-134R | Rat Cerebrum Tissue Lysate | +Inquiry |
GLYCTK-5887HCL | Recombinant Human GLYCTK 293 Cell Lysate | +Inquiry |
IGSF6-5255HCL | Recombinant Human IGSF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All srb-15 Products
Required fields are marked with *
My Review for All srb-15 Products
Required fields are marked with *
0
Inquiry Basket