Recombinant Full Length Sensor-Type Histidine Kinase Prrb(Prrb) Protein, His-Tagged
Cat.No. : | RFL18291MF |
Product Overview : | Recombinant Full Length Sensor-type histidine kinase prrB(prrB) Protein (O33071) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium leprae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRKLDEAAGFA IPFVPRGLDEIPRSPNDQDAIITVRRGNLVKSNFDITLPKLTNDYADTYLRGVRYRVRTV EIPAPEPTSIAVGATYDATVAETNNLHRRVLLICGFAIAAAAVFAWLLAAFAVRPFKQLA QQTRSVDAGGEAPRVEVHGATEAVEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSH ELRTPLTAMRTNLEVLATLDLADDQRKEVLGDVIRTQSRIEATLSALERLAQGELSTSDD HVPVDITELLDRAAHDATRSYPELKVSLVPSPTCIIVGLPAGLRLAVDNAVANAVKHGGA TRVQLSAVSSRAGVEIAVDDNGSGVPEDERQVVFERFSRGSTASHSGSGLGLALVAQQAQ LHGGTASLETSPLGGARLLLRISAPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | prrB |
Synonyms | prrB; ML2124; MLCB57.60c; Sensor-type histidine kinase PrrB |
UniProt ID | O33071 |
◆ Native Proteins | ||
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
SERPINC1-5487R | Native Rabbit Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAF12-1276HCL | Recombinant Human TAF12 293 Cell Lysate | +Inquiry |
PLEK2-3118HCL | Recombinant Human PLEK2 293 Cell Lysate | +Inquiry |
LY6H-4598HCL | Recombinant Human LY6H 293 Cell Lysate | +Inquiry |
CYP24A1-7122HCL | Recombinant Human CYP24A1 293 Cell Lysate | +Inquiry |
HLA-DMB-5500HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All prrB Products
Required fields are marked with *
My Review for All prrB Products
Required fields are marked with *
0
Inquiry Basket