Recombinant Full Length Sensor-Type Histidine Kinase Prrb(Prrb) Protein, His-Tagged
Cat.No. : | RFL31461MF |
Product Overview : | Recombinant Full Length Sensor-type histidine kinase prrB(prrB) Protein (P0A5Z9) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium Bovis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRRLDEAAGFA IPFVPRGLDEIPRSPNDQDALITVRRGNVIKSNSDITLPKLQDDYADTYVRGVRYRVRTV EIPGPEPTSVAVGATYDATVAETNNLHRRVLLICTFAIGAAAVFAWLLAAFAVRPFKQLA EQTRSIDAGDEAPRVEVHGASEAIEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSH ELRTPLTAMRTNLEVLSTLDLPDDQRKEVLNDVIRTQSRIEATLSALERLAQGELSTSDD HVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGA TLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSRGSTASHSGSGLGLALVAQQAQ LHGGTASLENSPLGGARLVLRLPGPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | prrB |
Synonyms | prrB; BQ2027_MB0926C; Sensor-type histidine kinase PrrB |
UniProt ID | P0A5Z9 |
◆ Native Proteins | ||
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
IgY-005C | Native Chicken IgY Ig Fraction | +Inquiry |
Hb-117M | Native Mouse Hb | +Inquiry |
TF-93R | Native Rat Transferrin | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSF2-5366HCL | Recombinant Human HSF2 293 Cell Lysate | +Inquiry |
MYRIP-4000HCL | Recombinant Human MYRIP 293 Cell Lysate | +Inquiry |
CRYGC-7258HCL | Recombinant Human CRYGC 293 Cell Lysate | +Inquiry |
METTL6-1084HCL | Recombinant Human METTL6 cell lysate | +Inquiry |
GPHA2-923HCL | Recombinant Human GPHA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All prrB Products
Required fields are marked with *
My Review for All prrB Products
Required fields are marked with *
0
Inquiry Basket