Recombinant Full Length Sensor Protein Zras(Zras) Protein, His-Tagged
Cat.No. : | RFL25861EF |
Product Overview : | Recombinant Full Length Sensor protein ZraS(zraS) Protein (Q8X614) (1-458aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-458) |
Form : | Lyophilized powder |
AA Sequence : | MRFMQRSKDSLAKWLSAILPVVIVGLVGLFAVTVIRDYGRETAAARQTLLEKGSVLIRAL ESGSRVGMGMRMHHAQQQALLEEMAGQPGVRWFAVTDEQGTIVMHSNSGMVGKQLYSPQE MQQLHPGDEEVWRRIDSADGEPVLEIYRQFQPMFAAGMHRMRHMQQYAATPQAIFIAFDA SNIVSAEDREQRNTLIILFALATVLLASVLSFFWYRRYLRSRQLLQDEMKRKEKLVALGH LAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSELLELVKP THLALQAVDLNTLINHSLQLVSQDANCREIQLRFTANDTLPEIQADPDRLTQVLLNLYLN AIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLEAIFTPYFTTKAEGTGLGLAVV HNIVEQHGGTIQVASLEGKGARFTLWLPVNITRKDPQG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zraS |
Synonyms | zraS; hydH; Z5579; ECs4926; Sensor protein ZraS |
UniProt ID | Q8X614 |
◆ Recombinant Proteins | ||
PAIP1-5426C | Recombinant Chicken PAIP1 | +Inquiry |
ARMC1-1900Z | Recombinant Zebrafish ARMC1 | +Inquiry |
CXCL8-350C | Active Recombinant Human CXCL8 Protein (77 aa) | +Inquiry |
IL33-0291C | Recombinant Cynomolgus IL33 protein, His-tagged | +Inquiry |
Atp6v1g1-1775M | Recombinant Mouse Atp6v1g1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
Lectin-1789G | Active Native Griffonia Simplicifolia Lectin II Protein, Fluorescein labeled | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPDC1-752HCL | Recombinant Human NPDC1 cell lysate | +Inquiry |
ANXA3-8832HCL | Recombinant Human ANXA3 293 Cell Lysate | +Inquiry |
AGBL2-8983HCL | Recombinant Human AGBL2 293 Cell Lysate | +Inquiry |
HSPB8-5345HCL | Recombinant Human HSPB8 293 Cell Lysate | +Inquiry |
CMBL-7421HCL | Recombinant Human CMBL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zraS Products
Required fields are marked with *
My Review for All zraS Products
Required fields are marked with *
0
Inquiry Basket