Recombinant Full Length Sensor Protein Qsec(Qsec) Protein, His-Tagged
Cat.No. : | RFL36108EF |
Product Overview : | Recombinant Full Length Sensor protein qseC(qseC) Protein (Q8X524) (1-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-449) |
Form : | Lyophilized powder |
AA Sequence : | MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDL NEINAADRMAQTPNKLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADG QLVGDKDQWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQLIPWLVALPVMLIIMMV LLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVESLNQLFARTHAMMVRERRF TSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLD SLDNLQDVAEIPLEDLLQSSVMDIYHTAQQAKIDVRLTLNVQGIKRTGQPLLLSLLVRNL LDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLS IVQRIAKLHGMNVEFGNAEQGGFEAKVSW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | qseC |
Synonyms | qseC; Z4378; ECs3908/ECs3909; Sensor protein QseC |
UniProt ID | Q8X524 |
◆ Recombinant Proteins | ||
ENPP3-2105R | Recombinant Rat ENPP3 Protein | +Inquiry |
SH-RS10210-5759S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS10210 protein, His-tagged | +Inquiry |
ALDH3A2-293C | Recombinant Cynomolgus ALDH3A2 Protein, His-tagged | +Inquiry |
RFL19321BF | Recombinant Full Length Burkholderia Mallei Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged | +Inquiry |
EXOSC1-230H | Recombinant Human EXOSC1, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100A1B-9H | Native Human S100A1B | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
VTN-5410H | Native Human Vitronectin | +Inquiry |
IgG1-014M | Native Mouse IgG1 Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCP11L1-1166HCL | Recombinant Human TCP11L1 293 Cell Lysate | +Inquiry |
KIFC1-363HCL | Recombinant Human KIFC1 lysate | +Inquiry |
PTER-2720HCL | Recombinant Human PTER 293 Cell Lysate | +Inquiry |
KLK6-1559HCL | Recombinant Human KLK6 cell lysate | +Inquiry |
BGN-1124MCL | Recombinant Mouse BGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All qseC Products
Required fields are marked with *
My Review for All qseC Products
Required fields are marked with *
0
Inquiry Basket