Recombinant Full Length Sensor Protein Dlts(Dlts) Protein, His-Tagged
Cat.No. : | RFL36533SF |
Product Overview : | Recombinant Full Length Sensor protein dltS(dltS) Protein (Q8E3C7) (1-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus agalactiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-395) |
Form : | Lyophilized powder |
AA Sequence : | MFSDLRKKFVFLTMSILIVVVLFLFAVSNRYNQYWDEYDAYRIVKLVAKNDYLGIPGDEP IALVTIDNQKMVKIQSNNTDLTNDVIEKSSLKLLEQGKKSRKWKSFIYSIKEYKDKTYTI AIMDLASYEVPYARRFLILVFTIFGFCLLAAVSLYLSRFIVGPVETEMTREKQFVSDASH ELKTPIAAIRANVQVLEQQIPGNRYLDHVVSETKRMEFLIEDLLNLSRLDEKRSKVNFKK LNLSVLCQEVLLTYESLAYEEEKCLNDTIEDDVWIVGEESQIKQILIILLDNAIRHSLSK SEIQFSLKQARRKAILTISNPSAIYSKEVMDNLFERFYQAKDDHADSLSFGLGLSIAKAI VERHKGRIRAYQEKDQLRLEVQLPIDGFWTNTMIN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dltS |
Synonyms | dltS; gbs1834; Sensor protein DltS |
UniProt ID | Q8E3C7 |
◆ Recombinant Proteins | ||
MKKS-10512Z | Recombinant Zebrafish MKKS | +Inquiry |
Grk1-3311M | Recombinant Mouse Grk1 Protein, Myc/DDK-tagged | +Inquiry |
NPR2-6172M | Recombinant Mouse NPR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGT-5413H | Recombinant Human AGT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL31796SF | Recombinant Full Length Schizosaccharomyces Pombe Protein Arv1(Arv1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1717U | Native Ulex europaeus Lectin | +Inquiry |
PLG-15H | Native Human Plasminogen Protein | +Inquiry |
Alb-503R | Native Rat Alb Protein | +Inquiry |
CAPN1-65P | Active Native Porcine Porcine Calpain 1 | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDIA3-3331HCL | Recombinant Human PDIA3 293 Cell Lysate | +Inquiry |
MMP8-2080MCL | Recombinant Mouse MMP8 cell lysate | +Inquiry |
FAM127C-6433HCL | Recombinant Human FAM127C 293 Cell Lysate | +Inquiry |
Esophagus-428S | Sheep Esophagus Lysate, Total Protein | +Inquiry |
CYP2C18-434HCL | Recombinant Human CYP2C18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dltS Products
Required fields are marked with *
My Review for All dltS Products
Required fields are marked with *
0
Inquiry Basket