Recombinant Full Length Sensor-Like Histidine Kinase Senx3(Senx3) Protein, His-Tagged
Cat.No. : | RFL29301MF |
Product Overview : | Recombinant Full Length Sensor-like histidine kinase senX3(senX3) Protein (P54883) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium leprae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MTVFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQMLQRIIALMP LGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQALGGDDVEFDLLPGKRPAAG RSGLSVHGHARLLSEKDRRFAVVFVHDQSDYVRMEAARRDFVANVSHELKTPVGAMALLA EALLASADDAETVSRFAEKVLIEANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSE AIARHKVAADTAAIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRR RGDNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHNGSI GVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNRPQREEEEFKSMTPAQAMM QSEVTRGNVNDKCPDCGGRGIAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | senX3 |
Synonyms | senX3; ML2440; B2168_C3_247; Sensor-like histidine kinase SenX3 |
UniProt ID | P54883 |
◆ Recombinant Proteins | ||
MOG-3593H | Recombinant Human MOG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDK4-4481C | Recombinant Chicken PDK4 | +Inquiry |
DEFB104A-85H | Recombinant Human Defensin, Beta 104A | +Inquiry |
SLITRK5-4140R | Recombinant Rhesus Macaque SLITRK5 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF4-191H | Recombinant Human TNFSF4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR3E-5332HCL | Recombinant Human HTR3E 293 Cell Lysate | +Inquiry |
TRIM63-1833HCL | Recombinant Human TRIM63 cell lysate | +Inquiry |
L1210-168H | L1210 Whole Cell Lysate | +Inquiry |
PPIAL4A-2974HCL | Recombinant Human PPIAL4A 293 Cell Lysate | +Inquiry |
TRPV2-733HCL | Recombinant Human TRPV2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All senX3 Products
Required fields are marked with *
My Review for All senX3 Products
Required fields are marked with *
0
Inquiry Basket