Recombinant Full Length Sensor Histidine Kinase Mtrb(Mtrb) Protein, His-Tagged
Cat.No. : | RFL20996MF |
Product Overview : | Recombinant Full Length Sensor histidine kinase mtrB(mtrB) Protein (Q9CCJ1) (1-562aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mycobacterium leprae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-562) |
Form : | Lyophilized powder |
AA Sequence : | MIFSSRRRIRGRWGRSGPMMRGMGALTRVVGVVWRRSLQLRVVALTFGLSLAVILALGFV LTSQLTSRVLDVKVRVAIEQIERARTTVTGIVNGEETRSLDSSLQLARNTLTSKTDPTSG AGLVGAFDAVLIVPGDGPRTATTAGPVDQVPNSLRGFIKAGQAAYQYATVHTEGFSGPAL IIGTPTSSQVTNLELYLIFPLKNEQATVTLVRGTMATGGMVLLVLLSGIALLVSRQVVVP VRSASRIAERFAEGHLSERMPVRGEDDMARLAVSFNDMAESLSRQITQLEEFGNLQRRFT SDVSHELRTPLTTVRMAADLIYDHSSDLDPTLRRSTELMVSELDRFETLLNDLLEISRHD AGVAELSVEAVDLRVMVNNALGNVGHLAEEAGIELLVDMPVDEVIAEVDARRVERILRNL IANAIDHSEHKPVRIRMAADEDTVAVTVRDYGIGLRPGEEKLVFSRFWRSDPSRVRRSGG TGLGLAISIEDARLHQGRLEAWGEPGQGACFRLTLPLVRGHKVTTSPLPMKPILQPSPQA STAGQQHGTQRQRLREHAERSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mtrB |
Synonyms | mtrB; ML0774; Sensor histidine kinase MtrB |
UniProt ID | Q9CCJ1 |
◆ Recombinant Proteins | ||
PFKP-4872H | Recombinant Human PFKP Protein (Asp553-Lys753), N-His tagged | +Inquiry |
VNN1-572H | Recombinant Human VNN1 Protein, His-tagged | +Inquiry |
IL11-151H | Recombinant Human IL11 Protein, His-tagged | +Inquiry |
CRLF3-1987M | Recombinant Mouse CRLF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGFA-16701M | Recombinant Mouse TGFA Protein | +Inquiry |
◆ Native Proteins | ||
MDH-38P | Active Native Porcine Malate dehydrogenase | +Inquiry |
Thrombin-24H | Active Native Human a-Thrombin | +Inquiry |
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
Trf-4782M | Native Mouse Transferrin | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
FARS2-6327HCL | Recombinant Human FARS2 293 Cell Lysate | +Inquiry |
TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
KLHL2-4911HCL | Recombinant Human KLHL2 293 Cell Lysate | +Inquiry |
UQCC1-491HCL | Recombinant Human UQCC 293 Cell Lysate | +Inquiry |
PPP2R5C-2916HCL | Recombinant Human PPP2R5C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mtrB Products
Required fields are marked with *
My Review for All mtrB Products
Required fields are marked with *
0
Inquiry Basket