Recombinant Full Length Sensor Histidine Kinase Dcus(Dcus) Protein, His-Tagged
Cat.No. : | RFL24460SF |
Product Overview : | Recombinant Full Length Sensor histidine kinase DcuS(dcuS) Protein (P59341) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella flexneri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MRHSLPYHILRKRPMKLSTTVILMVSAVLFSVLLVVHLIYFSQISDMTRDGLANKALAVA RTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPF KGDDILNALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQINDSR WSIIWSVLFGMLVGLIGTCILVKVLKKILFGLEPYEISTLFEQRQAMLQSIKEGVVAVDD RGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRL LLINTVPVRSNGVIIGAISTFRDKTEVRKLMQRLDGLVNYADALRERSHEFMNKLHVILG LLHLKSYKQLEDYILKTANNYQEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSE SQLPDSGSEDQVATLITTLGNLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGI APDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGER SNR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dcuS |
Synonyms | dcuS; SF4098; S3632; Sensor histidine kinase DcuS |
UniProt ID | P59341 |
◆ Native Proteins | ||
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
Fibrinogen-69C | Active Native Canine Fibrinogen | +Inquiry |
CA50-01H | Active Native Human Cancer Antigen 50 protein | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
FGB-46P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECHDC3-6729HCL | Recombinant Human ECHDC3 293 Cell Lysate | +Inquiry |
IER5-835HCL | Recombinant Human IER5 cell lysate | +Inquiry |
CSDC2-7250HCL | Recombinant Human CSDC2 293 Cell Lysate | +Inquiry |
Tonsil-536R | Rhesus monkey Tonsil Lysate | +Inquiry |
IFNA13-847MCL | Recombinant Mouse IFNA13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dcuS Products
Required fields are marked with *
My Review for All dcuS Products
Required fields are marked with *
0
Inquiry Basket