Recombinant Full Length Scyliorhinus Canicula Nadh-Ubiquinone Oxidoreductase Chain 4L(Mt-Nd4L) Protein, His-Tagged
Cat.No. : | RFL6713SF |
Product Overview : | Recombinant Full Length Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 4L(MT-ND4L) Protein (O79409) (1-98aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-98) |
Form : | Lyophilized powder |
AA Sequence : | MSPMYFSFSSAFMLGLMGLAFNRSHLLSALLCLEGMMLTLFVATATWSLMLNSTSSSILP MILLTFSACEASAGLAILVATSRSHGSDNLQNLNLLQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MT-ND4L |
Synonyms | MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L |
UniProt ID | O79409 |
◆ Recombinant Proteins | ||
PLEKHF2-6585H | Recombinant Human PLEKHF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MRI1-1551H | Recombinant Human MRI1 Protein, MYC/DDK-tagged | +Inquiry |
HAUS5-1815Z | Recombinant Zebrafish HAUS5 | +Inquiry |
TIMP2-603H | Recombinant Human TIMP2 Protein, His-tagged | +Inquiry |
ARPC1A-3534C | Recombinant Chicken ARPC1A | +Inquiry |
◆ Native Proteins | ||
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
Plg-1897R | Native Rat Plasminogen | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXADR-1102MCL | Recombinant Mouse CXADR cell lysate | +Inquiry |
CSRNP1-7236HCL | Recombinant Human CSRNP1 293 Cell Lysate | +Inquiry |
FATE1-6321HCL | Recombinant Human FATE1 293 Cell Lysate | +Inquiry |
Colon-95R | Rat Colon Membrane Lysate | +Inquiry |
VKORC1-405HCL | Recombinant Human VKORC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MT-ND4L Products
Required fields are marked with *
My Review for All MT-ND4L Products
Required fields are marked with *
0
Inquiry Basket