Recombinant Full Length Schizosaccharomyces Pombe Zinc Homeostasis Factor 1(Zhf1) Protein, His-Tagged
Cat.No. : | RFL18667SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Zinc homeostasis factor 1(zhf1) Protein (O13918) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MFDLARQTRIILLLGIDVTFFFIEIITGYAIDSLALIADSFHMLNDIVSLLVALWATRLA HSTSHEPKYTYGWQRAEILGALSNGVFLIALCMFIFMEAIERFIEPPSVSNPTLMFFVGS LGLLSNFVGIFLFHDHGHDHPHTHTAQNYDFPEEDDIESVLPSTIVHRCNTSQQEVSHTH TQVADSATESSPLLSYTGNHNGAGTSKPVNNHGSIEQDAPKQTKKRNLNMHGVFLHVLGD ALGNIGVISAALFIKYTDYSWRFLFDPCISILLTFIILFSAIPLCKSAALILLQVAPQSI KLDDVSNLINHLDGVESVHELHIWQLSDVKLIATVHVCVTLPDDKGESYTKLTTDIRNVL QSFGIYDVTIQPEFANHPLLCDQGSSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zhf1 |
Synonyms | zhf1; zhf; SPAC23C11.14; Zinc homeostasis factor 1 |
UniProt ID | O13918 |
◆ Recombinant Proteins | ||
HPS6-2561R | Recombinant Rat HPS6 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL34348AF | Recombinant Full Length Acidobacterium Capsulatum Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged | +Inquiry |
ESRP2-6017H | Recombinant Human ESRP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Protein A-2939S | Recombinant Staphylococcus aureus Protein A(Cys) | +Inquiry |
FAM162A-4528HF | Recombinant Full Length Human FAM162A Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
Progesterone-01H | Native Human Progesterone | +Inquiry |
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
Cela1 -71R | Active Native Rat pancreatic elastase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLTF-5489HCL | Recombinant Human HLTF 293 Cell Lysate | +Inquiry |
MGRN1-4328HCL | Recombinant Human MGRN1 293 Cell Lysate | +Inquiry |
AGFG2-8981HCL | Recombinant Human AGFG2 293 Cell Lysate | +Inquiry |
SMARCC2-1669HCL | Recombinant Human SMARCC2 293 Cell Lysate | +Inquiry |
Tongue-532D | Dog Tongue Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zhf1 Products
Required fields are marked with *
My Review for All zhf1 Products
Required fields are marked with *
0
Inquiry Basket