Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein Wtf9(Wtf9) Protein, His-Tagged
Cat.No. : | RFL23996SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein wtf9(wtf9) Protein (O74564) (1-333aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-333) |
Form : | Lyophilized powder |
AA Sequence : | MKNNYTSLKSPLDEEDELKTDHEIDLEKGPLPEYDSEEEGALPPYSDHALVNNPPNTHRE NHSSGTTDNSSPLLIKLLISFTSIILFNAPAVCYLKYKDAFFKNYGAVEWTLFGFWCFVC TLALIFLTYFYETWTKAVKVTVISLAQCVKVTAVFLAKCVKVTAVGLYNSREKWVVIIWL LWVVICYTLFLRAKFGNLNLDKALICSTCSISAALLLFLLYVRLPFWTLKHMFSGLFQVL GVQSCVVIVQKGLMHLFDKHIDGTGYEIEASSLFVIGNFLFFYEMECPGALKRMPKFIRN GIASFLGGIANAIGGANDNNDIPLEETEAESEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | wtf9 |
Synonyms | wtf9; wtf2; SPCC970.11c; Meiotic drive suppressor wtf9 |
UniProt ID | O74564 |
◆ Recombinant Proteins | ||
TRIM25-9597M | Recombinant Mouse TRIM25 Protein, His (Fc)-Avi-tagged | +Inquiry |
UQCRC2-17879M | Recombinant Mouse UQCRC2 Protein | +Inquiry |
FXYD1-3011H | Recombinant Human FXYD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL15925IF | Recombinant Full Length Ipomoea Purpurea Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged | +Inquiry |
HSPA8-2166R | Recombinant Rhesus monkey HSPA8 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TF-8271H | Native Human Serum Transferrin APO (Iron Free) | +Inquiry |
AGT-152H | Native Human Angiotensinogen | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
SOCS3-1580HCL | Recombinant Human SOCS3 293 Cell Lysate | +Inquiry |
LTA4H-731HCL | Recombinant Human LTA4H cell lysate | +Inquiry |
LS1034-2152H | LS1034 (human cecal carcinoma) whole cell lysates | +Inquiry |
SLC30A8-1737HCL | Recombinant Human SLC30A8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All wtf9 Products
Required fields are marked with *
My Review for All wtf9 Products
Required fields are marked with *
0
Inquiry Basket