Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C630.12(Spac630.12) Protein, His-Tagged
Cat.No. : | RFL27588SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C630.12(SPAC630.12) Protein (Q9UUH0) (20-422aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-422) |
Form : | Lyophilized powder |
AA Sequence : | EKIIHTRPHKKCDWRSWEQWESTGNPVRIALVADPQLVDDLTYDYPRPLIGIVKWISDQF LRRHWRYLHKSLKPDITFIMGDLMDTGREFATEEFKKDYFRMMNVLDPKFTNKLEIYPGN HDIGFGNHAIVKDIQRFESLFGPTSRSIDVGNHTLVIVDGIRLSNNVNPQVYQPARDFLK SFETNKDNSRPRILLSHVPLFRPAINSCGELREKDDVIKYGLGYQYQNLLLPELSESILK AVEPIAAFAGDDHDYCEVVHNYQVDTREAATTEYNVKAFSMTSGILYPGYQLLSLNYPYD NPKADQKSSYQTKLCILPNQIQIYVWYGASISIFFALILLRTAIFFFGTDRYSLPLYKTH ARRFSLSTTIHLFKKIVRITLSTFISYTWIPFLLFIFLNIFII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC630.12 |
Synonyms | SPAC630.12; Uncharacterized protein C630.12 |
UniProt ID | Q9UUH0 |
◆ Recombinant Proteins | ||
VPS45-6200R | Recombinant Rat VPS45 Protein, His (Fc)-Avi-tagged | +Inquiry |
OSTC-1574HF | Recombinant Full Length Human OSTC Protein, GST-tagged | +Inquiry |
LETM2-3383R | Recombinant Rat LETM2 Protein | +Inquiry |
RFL15737HF | Recombinant Full Length Helianthus Annuus Photosystem Ii D2 Protein(Psbd) Protein, His-Tagged | +Inquiry |
ASPSCR1-2934H | Recombinant Human ASPSCR1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Streptolysin-171S | Native Streptolysin O protein | +Inquiry |
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
CII-250C | Native Chicken CII | +Inquiry |
COD-39 | Active Native Choline oxidase | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TYK2-1867HCL | Recombinant Human TYK2 cell lysate | +Inquiry |
HMGB3-801HCL | Recombinant Human HMGB3 cell lysate | +Inquiry |
TNK1-886HCL | Recombinant Human TNK1 293 Cell Lysate | +Inquiry |
GZMA-5668HCL | Recombinant Human GZMA 293 Cell Lysate | +Inquiry |
SOCS6-1577HCL | Recombinant Human SOCS6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC630.12 Products
Required fields are marked with *
My Review for All SPAC630.12 Products
Required fields are marked with *
0
Inquiry Basket