Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C56F8.07(Spac56F8.07) Protein, His-Tagged
Cat.No. : | RFL34929SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C56F8.07(SPAC56F8.07) Protein (Q10255) (1-507aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-507) |
Form : | Lyophilized powder |
AA Sequence : | MKVVSLRRIYSSEIYKLPTTRLHMDTLYYYYFVSHLAAALFVDLPITEWLGGSLSCLSGL RRFYLSTYEDPILLIPAPWKTALFSSELFFQVPFFIWVSLRLRKKARDPVLWVAILIYGV HAFTTTWCCMFELFAEKKWMIMSFYFPYLAIPLWMAIDMGGRLVKSCHAAKSGPSSTITS KKNIRQTILATPFLLNRIRTEFPQLAAVLNDPNAFATTWQSINASQLLQIPSSTYSMGMP SFSEDDLFDVEVQRRIEEQIRQNAVTENMQSAIENHPEVFGQVYMLFVNVEINGHKVKAF VDSGAQATILSADCAEKCGLTRLLDTRFQGVAKGVGMAKILGCVHSAPLKIGDLYLPCRF TVIEGRDVDMLLGLDMLRRYQACIDLENNVLRIHGKEIPFLGESEIPKLLANVEPSANAH GLGIEPASKASASSPNPQSGTRLGTKESVAPNNEGSSNPPSLVNPPTDPGLNSKIAQLVS MGFDPLEAAQALDAANGDLDVAASFLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC56F8.07 |
Synonyms | SPAC56F8.07; Uncharacterized membrane protein SPAC56F8.07 |
UniProt ID | Q10255 |
◆ Recombinant Proteins | ||
ARL3-6199H | Recombinant Human ARL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL21R-326H | Recombinant Human IL21R Protein, Fc-tagged | +Inquiry |
RFL17637DF | Recombinant Full Length Dictyostelium Discoideum Srfa-Induced Gene J Protein(Sigj) Protein, His-Tagged | +Inquiry |
Ltf-7670M | Recombinant Mouse Ltf protein, His & GST-tagged | +Inquiry |
RBM38-2215H | Recombinant Human RBM38, His-tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Apotransferrin-38R | Native Rat Apotransferrin | +Inquiry |
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
GG-182B | Native Bovine Gamma Globulin | +Inquiry |
IgG1-228H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPL50-4159HCL | Recombinant Human MRPL50 293 Cell Lysate | +Inquiry |
LRR1-1398HCL | Recombinant Human LRR1 cell lysate | +Inquiry |
CES3-636HCL | Recombinant Human CES3 cell lysate | +Inquiry |
PTPN12-002HCL | Recombinant Human PTPN12 cell lysate | +Inquiry |
AP2S1-8812HCL | Recombinant Human AP2S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SPAC56F8.07 Products
Required fields are marked with *
My Review for All SPAC56F8.07 Products
Required fields are marked with *
0
Inquiry Basket