Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein C1E8.03C (Spbc1E8.03C) Protein, His-Tagged
Cat.No. : | RFL21779SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein C1E8.03c (SPBC1E8.03c) Protein (O42968) (1-477aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-477) |
Form : | Lyophilized powder |
AA Sequence : | MVVIANKGALWAYYCKRLLNSVTYMMYPLIRKRTMKKLLLIVGLLLACSTVMRRIPLFHE SFHLPSLDPRASTTTSQKFQEYRSDFLEKLETAEPPEDVIMFTAYGLGVHTHNLFMLACD MAKTSDSQIRFLLLTDGTILPEALYDYNRETVSTCPLSFLSYSTGVERLSKELILKDLLS LQFQQALLAISPSVIVTSEHSPLVMFQAINPYLNNNYYTHDTVDTNALEENSWITKLDMQ SLQHFRTPRINVVLIVEDGTYKYLLNLMRDLGRDFKNSEEYPHLFIHLFMSENIPNLSSI RANWPQHRLFINLHFNQKDLNLIEVWTPPNDYTYALVVDLQPDSPPQLSSNLITWLKYKI LLIYYHKSSSTYKNNIAAIVPSFDFSNEEAVILSQTINSNIVLFAPVVFQKFQEYMAVRL LNPNFELPESNGIEFAHEDSVLGHSKPSLTEFHAILGLYSLVISYNHFEGSLSNEYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC1E8.03c |
Synonyms | SPBC1E8.03c; Uncharacterized protein C1E8.03c |
UniProt ID | O42968 |
◆ Recombinant Proteins | ||
ANXA7-299C | Recombinant Cynomolgus ANXA7 Protein, His-tagged | +Inquiry |
PVALB6-11614Z | Recombinant Zebrafish PVALB6 | +Inquiry |
SMARCA4-8461M | Recombinant Mouse SMARCA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CMTM7-3638M | Recombinant Mouse CMTM7 Protein | +Inquiry |
WNT6-10200M | Recombinant Mouse WNT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Crp-5382R | Native Rat C-Reactive Protein, Petaxin Related | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
ALB-313B | Native Bovine Albumin, Texas Red Label | +Inquiry |
Fibrinogen-71R | Active Native Rabbit Fibrinogen | +Inquiry |
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NP-001HCL | Recombinant H1N1 NP cell lysate | +Inquiry |
Heart Atrium-202H | Human Heart Atrium (RT) (Arrhythmia, infarct) Lysate | +Inquiry |
Liver-282H | Human Liver Cytoplasmic Lysate | +Inquiry |
SMPDL3A-1216HCL | Recombinant Human SMPDL3A cell lysate | +Inquiry |
RPL8-2187HCL | Recombinant Human RPL8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC1E8.03c Products
Required fields are marked with *
My Review for All SPBC1E8.03c Products
Required fields are marked with *
0
Inquiry Basket