Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Metal Transporter C16E9.14C (Spbc16E9.14C) Protein, His-Tagged
Cat.No. : | RFL33596SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized metal transporter C16E9.14c (SPBC16E9.14c) Protein (O14329) (1-386aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-386) |
Form : | Lyophilized powder |
AA Sequence : | MTQNHNIPTAIQIQNPINNNVSVTISDQLPKPSANNPNLLSVDTRPTHRKGHHHKHSLSH QYFLPPKNRQPLEIPASYPIPTFKETFAILTFPQKLKLTSSILFFLVAVGVLLSGDATIL LTLSCSLIVEGVLIIINVWRETLDSFLVWRHTCLRYPFGMQQMELLVDFSFSILLIFLGM NLLKEPAEHAIEDWGNLHHAGDHEEETVHIHLTISLFASAIISGFALLLDHPSAHIRELN SRFFHGLTLVPSLILVLLLSLGYQVGSFLSHLLSLTIAVTALVNGFSIAKSLALMLLLTY SNKEKVFECVSLIKEDTRIDQLNYAAIWQPHYNTCIANIGLTVSGGEREQAAVREDIIRI IQKTVGSIFGAGVQPKWEISVDIQRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zrg17 |
Synonyms | zrg17; SPBC16E9.14c; Probable zinc transporter zrg17 |
UniProt ID | O14329 |
◆ Native Proteins | ||
PTI-29B | Active Native Bovine Aprotinin | +Inquiry |
PRC1-5267P | Active Native Yeast PRC1 Protein | +Inquiry |
ALB-315B | Native Bovine ALB protein | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
CP-5326H | Native Human Ceruloplasmin (ferroxidase) | +Inquiry |
◆ Cell & Tissue Lysates | ||
THPO-001HCL | Recombinant Human THPO cell lysate | +Inquiry |
CDKN1A-7618HCL | Recombinant Human CDKN1A 293 Cell Lysate | +Inquiry |
UGP2-515HCL | Recombinant Human UGP2 293 Cell Lysate | +Inquiry |
STARD10-1423HCL | Recombinant Human STARD10 293 Cell Lysate | +Inquiry |
Fetal Throat-172H | Human Fetal Throat Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zrg17 Products
Required fields are marked with *
My Review for All zrg17 Products
Required fields are marked with *
0
Inquiry Basket