Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Metal Transporter C1020.03 (Spcc1020.03) Protein, His-Tagged
Cat.No. : | RFL9617SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized metal transporter C1020.03 (SPCC1020.03) Protein (O59758) (1-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-397) |
Form : | Lyophilized powder |
AA Sequence : | MLKTFNSSARSCRAMPRFLPTLCSRLHEKSGFEIRNAVRMHSVGSHTHTHDHGSDKEMLE LVKALKKEGKSPELKLAWLGLYSNIGLAAAKGIGGVALQSSILVADAAHQLGDTLSDLVT LATLKICSKKPTQKYPAGFGKWETIGTFTVSGLLVAVSVGIAHSSLSRLYTILFPYAGSE HTHIGHSHNPSQLLFEHPFMALGLIFGSVVLKEWLFRKTRTVAQKTDSNILLANAWHHRA DALTGMVSLLALSGTYFLNAPWLDPFFGCLVSIVVFSAGFNSSKKAFLQLLDRAPSEELR IAVTDALLKGEKLPYKIVTILGNAHAMHVIISVPPSFTSQQSSELAQKVEKTVLDAIPAL SSCIVTPLSSDSNQVHRWQHLNGSSGEHSHPSHEHTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPCC1020.03 |
Synonyms | SPCC1020.03; Uncharacterized metal transporter C1020.03 |
UniProt ID | O59758 |
◆ Recombinant Proteins | ||
P22K15-3889R | Recombinant Rat P22K15 Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF169-7663M | Recombinant Mouse RNF169 Protein, His (Fc)-Avi-tagged | +Inquiry |
AYP1020-RS08520-6198S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS08520 protein, His-tagged | +Inquiry |
NGF-537H | Recombinant Human NGF protein, His-tagged | +Inquiry |
RBPJ-3828R | Recombinant Rhesus monkey RBPJ Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1755C | Active Native Canavalia ensiformis Concanavalin A Protein | +Inquiry |
C. jejuni-24 | Native Campylobacter jejuni Antigen | +Inquiry |
Arp 2/3 complex-856P | Native Porcine Arp 2/3 complex Protein | +Inquiry |
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOHLH2-1667HCL | Recombinant Human SOHLH2 cell lysate | +Inquiry |
RAB20-2621HCL | Recombinant Human RAB20 293 Cell Lysate | +Inquiry |
DMRTC2-6897HCL | Recombinant Human DMRTC2 293 Cell Lysate | +Inquiry |
GFRA1-966CCL | Recombinant Canine GFRA1 cell lysate | +Inquiry |
BID-8456HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPCC1020.03 Products
Required fields are marked with *
My Review for All SPCC1020.03 Products
Required fields are marked with *
0
Inquiry Basket