Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Membrane Protein C21B10.06C(Spbc21B10.06C) Protein, His-Tagged
Cat.No. : | RFL33238SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized membrane protein C21B10.06c(SPBC21B10.06c) Protein (Q9USW2) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MNVDTQLSRDGLYSSLRTRYKVYISMHAFAIWHRFISFLAIYLWPCIMGSVNLNLQDREN EYFFDSIQYIIYTSELLVGDHELQRSHHEEQPSLVYPSSSFSSTSKFWRYFAYLLSLQIV IDFVLYKLSSAMASLHYLKFVKIIALSYICFSSLIRICHCWTYFIRIMGLSSLNKFVNLL HDFETTSNRVYSQICELEANSAANRSRLMDFLPANDPLLFNLTEQNTLSYELSGLYEKLL PRYQLVLSRIYPYAAASNLRNLLSLYRLPNCFGKLNSFDLRKGSSTSLKRSSMYLARKEN QDFDDQSTQILNHIKTAYYELTIISKQVLCCILSFPVDSFLAERSSWLIVHREVGDLSNA LSVSMVRLVDILKFSVESVNRNQHNTTSKPFPRIMCKENLRSLFNELHSVMMETHESISS YIQEGDNTAMQTYAMDEYDQVGLLLKDLLSEWDFNRALLLNLQHMHRKRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | inp2 |
Synonyms | inp2; SPBC21B10.06c; Inheritance of peroxisomes protein 2 |
UniProt ID | Q9USW2 |
◆ Recombinant Proteins | ||
PSMA8-7208M | Recombinant Mouse PSMA8 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTH-4818R | Recombinant Rat PTH Protein | +Inquiry |
Itgb2-7146R | Recombinant Rat Itgb2 protein, His & T7-tagged | +Inquiry |
USP13-9949M | Recombinant Mouse USP13 Protein, His (Fc)-Avi-tagged | +Inquiry |
TP53BP1-2302H | Recombinant Human TP53BP1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
FABP3-10R | Native Rat FABP3 protein | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
SERPINC1-5487R | Native Rabbit Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RTP1-2118HCL | Recombinant Human RTP1 293 Cell Lysate | +Inquiry |
KNG1-2276MCL | Recombinant Mouse KNG1 cell lysate | +Inquiry |
GNAI3-5869HCL | Recombinant Human GNAI3 293 Cell Lysate | +Inquiry |
DAZL-7068HCL | Recombinant Human DAZL 293 Cell Lysate | +Inquiry |
ZNF596-39HCL | Recombinant Human ZNF596 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All inp2 Products
Required fields are marked with *
My Review for All inp2 Products
Required fields are marked with *
0
Inquiry Basket