Recombinant Full Length Schizosaccharomyces Pombe Sporulation-Specific Protein Spo7(Spo7) Protein, His-Tagged
Cat.No. : | RFL10538SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Sporulation-specific protein spo7(spo7) Protein (Q9USQ0) (1-180aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-180) |
Form : | Lyophilized powder |
AA Sequence : | MSSYVPNTLSVYHNLLILEASFRKTYLQLQVRRQKYMAFYVSLLVWNFYFGYRVFYRISK YSLIDLTYKLCLLCGIVTLLLFYFSGLYRTTIVYPSRYVQQVNKAMRFFNIRLVITPVPW FQVRKPLDCGVHLILSSKRFDILVIEGWEAFRSSYFASIHRKNNSIQSNESSESPSSKQN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | spo7 |
Synonyms | spo7; SPBC902.03; Sporulation-specific protein spo7 |
UniProt ID | Q9USQ0 |
◆ Recombinant Proteins | ||
ALOX15-324H | Recombinant Human ALOX15 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd83-8777R | Recombinant Rat Cd83 protein(Met1-Ala134), His-tagged | +Inquiry |
SSP-RS02065-0348S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS02065 protein, His-tagged | +Inquiry |
EPHX1-205H | Recombinant Human EPHX1 | +Inquiry |
BTN1A1-7783H | Recombinant Human BTN1A1 protein(Met1-Arg242), His&Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
IgM-338H | Native Horse IgM | +Inquiry |
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
FABP-178R | Native Rat Fatty acid Binding Protein | +Inquiry |
S100B-1116H | Native Human S100B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACYBP-7898HCL | Recombinant Human CACYBP 293 Cell Lysate | +Inquiry |
Pancreas-42H | Human Pancreas Tumor Tissue Lysate | +Inquiry |
APOBEC4-31HCL | Recombinant Human APOBEC4 lysate | +Inquiry |
C4orf27-118HCL | Recombinant Human C4orf27 lysate | +Inquiry |
PRB1-2892HCL | Recombinant Human PRB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All spo7 Products
Required fields are marked with *
My Review for All spo7 Products
Required fields are marked with *
0
Inquiry Basket