Recombinant Full Length Schizosaccharomyces Pombe Sad1-Interacting Factor 2(Sif2) Protein, His-Tagged
Cat.No. : | RFL20010SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Sad1-interacting factor 2(sif2) Protein (O74446) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MSNRIGPQRSTKTAAKLRLLPSTEEFDDFRRQDTGREVYSQIPQIEGSTAKRDAEHLGKR HREFLPRVTAYCTCDTFRVDLLFKFFQSRRSSHKTRPKQFDECIYSPYSYNNEETTDLLP DTLESSRGTLNRESSQESLQSIFEESGLDRNQPLFREVFCFTYGVVVLWGYTIDEEHRFL RELGRFEIEKLKIEDMEVEEFNYYITTLYQPRIFNDFIALRDASNYMIRLSISHAIAQSV KISLFEELVNETIDATKDTPQMIAETGRVNLKREEIMMAVGQLFILRININLQGSVLDSP ELMWTEPQLEPIYTAARSYLEINQRVALLNQRVEVIGDLLSMLKEQITHTHDESLEWIVV ILMGLLVLIALFSIVVDWKLFQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | sif2 |
Synonyms | sif2; SPCC16C4.01; SPCC5E4.09; Sad1-interacting factor 2; Sporulation protein sif2 |
UniProt ID | O74446 |
◆ Native Proteins | ||
Ferritin-181R | Native Rat Ferritin | +Inquiry |
LDL-12H | Native Human LDL Protein | +Inquiry |
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
IgG-334D | Native Donkey IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF596-39HCL | Recombinant Human ZNF596 293 Cell Lysate | +Inquiry |
SLC7A6OS-1696HCL | Recombinant Human SLC7A6OS 293 Cell Lysate | +Inquiry |
CCL23-7727HCL | Recombinant Human CCL23 293 Cell Lysate | +Inquiry |
KLF8-940HCL | Recombinant Human KLF8 cell lysate | +Inquiry |
AMTN-001HCL | Recombinant Human AMTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All sif2 Products
Required fields are marked with *
My Review for All sif2 Products
Required fields are marked with *
0
Inquiry Basket