Recombinant Full Length Schizosaccharomyces Pombe Putative Erad-Associated E3 Ubiquitin-Protein Ligase Component(Spbc28F2.08C) Protein, His-Tagged
Cat.No. : | RFL9854SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Putative ERAD-associated E3 ubiquitin-protein ligase component(SPBC28F2.08c) Protein (Q9USV0) (21-713aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-713) |
Form : | Lyophilized powder |
AA Sequence : | VIGGEFSYDNIDKKPILVASYPEGSRFNVSASIKTLPDLVTLTFPKLVKDPGYVYEEAEK GDPESQFLIAMLYAMGPDERLGLSFPRNEPLSRIFLELSATQNYTYALLALAYKHLNGLS TPMSVDKGVELYKQVAHQISCLVQPLSHFAPDIAAEYPVDLYDLSRTSSYSVQKKDDIVE YLKDYALRGNNISAHISLATIYQYGTPGKLKDIKLAVKHYLAAIRLVNSGIPDSPSEAIK SIHNNPRHAPTTKETANSLSIAAFRLGCMALHGELGKPDPSLAYAWFEYGVSLNHSSSKA AIAYMYFMGYPVAENTESITKLLENALASNDPLAFAVAGKVSLANGQIDEATVHLIRAVS NGHLESVLHIADIYYGSNNQLSIAYYENFISRVLELFDVKTISFDPLTRHFAHRLSAELG NLMSQILAAKDRDPSTSYLKTVIFPTNEQTHRNARIAMNYYSRAAARNHIHSLIKIGDFY RMGLGTSAKPELAFSYYSQAAAIHPSALAYWRLGWMHEYGVGVPVDFEMAKKNYDNALMH DTRAFLAVTLARLRMRLSSPDSWFSNIYRILGKVTYKFLKLVQYFIINIFDILSPAGPDS QLPPEPPTLQVDRTPQQPDPQETSESLPSPNTEEMGESYNDIRFTYDYIDGRFLETACVT LIVVVVGLVLMRRHQQHRLQERRERIIRRQNRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC28F2.08c |
Synonyms | SPBC28F2.08c; Putative ERAD-associated E3 ubiquitin-protein ligase component |
UniProt ID | Q9USV0 |
◆ Recombinant Proteins | ||
EFNB1-1219R | Recombinant Rhesus Macaque EFNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESR1-2299H | Recombinant Human ESR1 Protein (Met1-Val595), C-His tagged | +Inquiry |
RFL18446MF | Recombinant Full Length Mouse Bri3-Binding Protein(Bri3Bp) Protein, His-Tagged | +Inquiry |
araA-1469A | Recombinant Anoxybacillus flavithermus araA Protein (M1-R496), His/CL7-tagged | +Inquiry |
CYP2A1-1723R | Recombinant Rat CYP2A1 Protein | +Inquiry |
◆ Native Proteins | ||
Lecithin-10S | Native Soy Lecithin | +Inquiry |
Tropomyosin/Troponin-895R | Native Rabbit Tropomyosin/Troponin Protein | +Inquiry |
Elastase-26P | Native Pseudomonas Aeruginosa Elastase | +Inquiry |
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
Hemocyanin-31S | Native Shrimp hemocyanin Protein, a substitute for KLH, animal free, SMCC Activated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRRF-4130HCL | Recombinant Human MRRF 293 Cell Lysate | +Inquiry |
PFKFB3-471HCL | Recombinant Human PFKFB3 cell lysate | +Inquiry |
UTF1-449HCL | Recombinant Human UTF1 293 Cell Lysate | +Inquiry |
CD38-1557HCL | Recombinant Human CD38 cell lysate | +Inquiry |
TNFRSF19-2454MCL | Recombinant Mouse TNFRSF19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC28F2.08c Products
Required fields are marked with *
My Review for All SPBC28F2.08c Products
Required fields are marked with *
0
Inquiry Basket