Recombinant Full Length Schizosaccharomyces Pombe Probable Glycosidase C21B10.07(Spbc21B10.07) Protein, His-Tagged
Cat.No. : | RFL27943SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Probable glycosidase C21B10.07(SPBC21B10.07) Protein (Q9USW3) (1-419aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-419) |
Form : | Lyophilized powder |
AA Sequence : | MGIPDSTTDSRHSLSSAALSSASFENIYDPARKNESTNDVIDNHTDTEIDDHDNDHENLD SNNNNENNEAFNEKAAEKKLLPWYRRYFIWILIFIVALICSVLIGVLGGVLGHRTAVRDR HPSYKAKTYSLVKEYKGTTFFDGFDFMNITDPTHGFVQYLDRNSSAKLGLISANSSNVIM AADSKHNYSSGRPSIRLQSTQYFEHGLFILDLIHLPYGCGTWPAFWTLGDDWPNGGEIDI VEGVNVGTSNQVTLHTGDGCEMEDIKRVMTGTALQTNCWVDAPNSYNAGCGVENPSGPSY GEAFNKNGGGVFVLDWRSEGIRSWFFNRSEIPSDITSGSPQPAKWSEPVADFPDTKCDID KMFSKQKILFDLTFCGDWAGSSVYSSAGCPGSCNDFVGNNPHNFTEAYWNIKSLAVYQY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC21B10.07 |
Synonyms | SPBC21B10.07; Probable glycosidase C21B10.07 |
UniProt ID | Q9USW3 |
◆ Native Proteins | ||
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
Lectin-1783G | Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, DyLight 594 Labeled | +Inquiry |
Collagen Type I-524B | Native Bovine Collagen Type I Protein, FITC-conjugated | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
THP-1-31HL | Human THP-1 lysate | +Inquiry |
FBXO17-6307HCL | Recombinant Human FBXO17 293 Cell Lysate | +Inquiry |
SELENBP1-1984HCL | Recombinant Human SELENBP1 293 Cell Lysate | +Inquiry |
HNRNPH3-5444HCL | Recombinant Human HNRNPH3 293 Cell Lysate | +Inquiry |
RBPJ-2453HCL | Recombinant Human RBPJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC21B10.07 Products
Required fields are marked with *
My Review for All SPBC21B10.07 Products
Required fields are marked with *
0
Inquiry Basket