Recombinant Full Length Schizosaccharomyces Pombe Probable Caax Prenyl Protease 1(Spac3H1.05) Protein, His-Tagged
Cat.No. : | RFL24560SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Probable CAAX prenyl protease 1(SPAC3H1.05) Protein (Q10071) (1-474aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-474) |
Form : | Lyophilized powder |
AA Sequence : | MSPGLCFLKEISVIQATPKPTTRSFANCCKMGILQHLMHILDIPGFPWKIVIAGFSIGKY AWDLYLRRRQVPYLLREKPPAILAEHVDEKKYQKALSYARDKSWFSTIVSTFTLAVDLLI IKYDGLSYLWNITKFPWMDKLAASSSRFSLSTSITHSCVFMFGLTLFSRLIQIPFNLYST FVIEEKYGFNKSTLKIFVIDLLKELSLGGLLMSVVVGVFVKILTKFGDNFIMYAWGAYIV FGLILQTIAPSLIMPLFYKFTPLENGSLRTQIEELAASINFPLKKLYVIDASRRSTHSNA FFYGLPWNKGIVLFDTLVKNHTEPELIAILGHELGHWYMSHNLINTIIDYGMSLFHLFLF AAFIRNNSLYTSFNFITEKPVIVGLLLFSDALGPLSSILTFASNKVSRLCEYQADAFAKQ LGYAKDLGDGLIRIHDDNLSPLEFDSLYTSYYHSHPILVDRLNAIDYTTLKKNN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPAC3H1.05 |
Synonyms | SPAC3H1.05; Probable CAAX prenyl protease 1; Prenyl protein-specific endoprotease 1; PPSEP 1 |
UniProt ID | Q10071 |
◆ Recombinant Proteins | ||
RFL16948LF | Recombinant Full Length Lolium Perenne Photosystem I Assembly Protein Ycf4(Ycf4) Protein, His-Tagged | +Inquiry |
CRP-7313H | Recombinant Human CRP protein, His-tagged | +Inquiry |
PON1-3305R | Recombinant Rat PON1 protein, His-SUMO-tagged | +Inquiry |
AQP2-5516C | Recombinant Chicken AQP2 | +Inquiry |
SAP076A-031-4128S | Recombinant Staphylococcus aureus (strain: PM86, other: HA-MRSA) SAP076A_031 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
FGA-39B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
HbA1c-21R | Native Rhesus monkey Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
GOT-186S | Active Native Porcine Glutamate Oxaloacetate Tranasminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHB6-2421HCL | Recombinant Human EPHB6 cell lysate | +Inquiry |
HIST1H2AB-5549HCL | Recombinant Human HIST1H2AB 293 Cell Lysate | +Inquiry |
PTER-2720HCL | Recombinant Human PTER 293 Cell Lysate | +Inquiry |
PTH2-2705HCL | Recombinant Human PTH2 293 Cell Lysate | +Inquiry |
FGGY-6230HCL | Recombinant Human FGGY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPAC3H1.05 Products
Required fields are marked with *
My Review for All SPAC3H1.05 Products
Required fields are marked with *
0
Inquiry Basket