Recombinant Full Length Schizosaccharomyces Pombe Nuclear Envelope Protein Ndc1(Cut11) Protein, His-Tagged
Cat.No. : | RFL10099SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Nuclear envelope protein ndc1(cut11) Protein (O13961) (1-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-601) |
Form : | Lyophilized powder |
AA Sequence : | MVMLRTSFPSGSRTKAVRYHTLLRPILQQRFLRACFALLCLCCITSYWFSSGPFISLSFW FLSLVRGFVCFFFMFPYFVMLKSRMSTQKVTKQSLGAQLFYDFSPKSFFLVYLTFAVSVS CLCLFYIKGHASSIRLQWIASPNAYELPSLNERFVYMTYFSHILILALTVEHLYLQRDSP SRPVINVSFFNYIFQNLGWLIRFSFRKSIICCLFTPFSYAILRSYIWRFAALLTSCCRRI AYTKTPPKWPLSLRLLLHSFWMAFIVCLTFQIALLIFRVFLYSGPMIRGKLLSARSNDPN GTLVDGMKTKKKPLTECIATEELWFIAKRDPQRIKSIFQDIDRSVSIWQELYSITESRCK ELATSLKILQSTGDFSAATSKKSGLTKKTNIPYSPNSNHEEINSIPLRNKNIFVPPSQGH SPLLEKIKKQGSLPSTTPVNEGGISDIIPKSLYDQVIRFISTFYKAPVFGIFRKTLRRQN EALLPNPWLFCVTVNSLTQLVLKSLKYDTYGVVARDISSILAVYCDTFDVLVSYKRSLVK NHSNSTNLDDDFKNLNSAANALHCGIIDITEKFQDFFTQLNLSPRIERRCWVLFREYKSN S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cut11 |
Synonyms | cut11; ndc1; SPAC1786.03; SPAC24C9.01; Nuclear envelope protein ndc1; Cell untimely torn protein 11 |
UniProt ID | O13961 |
◆ Native Proteins | ||
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
C1R-96H | Active Native Human C1r Enzyme | +Inquiry |
PRC1-5267P | Active Native Yeast PRC1 Protein | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
V8Protease-01S | Active Native Staph aureus V8 Protease, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R14A-2945HCL | Recombinant Human PPP1R14A 293 Cell Lysate | +Inquiry |
HOXD9-5409HCL | Recombinant Human HOXD9 293 Cell Lysate | +Inquiry |
EPB41-560HCL | Recombinant Human EPB41 cell lysate | +Inquiry |
HERPUD1-5584HCL | Recombinant Human HERPUD1 293 Cell Lysate | +Inquiry |
IL8-3004HCL | Recombinant Human IL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cut11 Products
Required fields are marked with *
My Review for All cut11 Products
Required fields are marked with *
0
Inquiry Basket