Recombinant Full Length Schizosaccharomyces Pombe Mitochondrial Outer Membrane Protein C83.16C (Spbc83.16C) Protein, His-Tagged
Cat.No. : | RFL30626SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Mitochondrial outer membrane protein C83.16c (SPBC83.16c) Protein (O94699) (1-563aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-563) |
Form : | Lyophilized powder |
AA Sequence : | MSKSQEQRLQNFVTVIQGLNDILDDKMDEATEKFKSGNSSFHLSGQAVVAFIQAVLTFEP SRFKDSQNRIDIAIKALSADKDDASKNNTFLSTFDPGVEYRVSIGLMLLLSALIGFCSES IVTSVKSVYKLRKAHSIFSKINKRHFDHFSAAFHSTGRSDVDLANEYVQTGTLLCTGLFT LLISLLPPKMITILNVFGYKGDRDWALQCMWMPALQRPTSFFAAVAFAALIQYYSGAVQL CSIYKKTPEEPDGWPDKRCFEILEKVEKAHPDGPMWPLHRAKLLSMVKKQDEAIVVLEEL MAKPPPRLKQLEVLIVFEHALDCAFSHRYVDGANSFLKLSSLNDSSTALYSYFAAACFLQ DVHVNANVEALEKASKLLEPLHDLVANKTAPLDVHIRRKVGKLIKRRASAGNQGGLAEYV GFSPLYELVYVWNGFRRMTDDELSKFDVERMEPWQDQDDDICQALIKATVLRNLGRTDEV FPILQKICAVTRTTETWAVAFAHYEMAVAFFESNGSKKEGLKHCDAYLRKARDFGGDNEF ESRLIIRVQLARHVVRKCLQSMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC83.16c |
Synonyms | SPBC83.16c; Inclusion body clearance protein IML2 |
UniProt ID | O94699 |
◆ Native Proteins | ||
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
BL-001C | Native Cynomolgus Brain Total Protein Lysates | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
Hemoglobin F-034H | Native Human Hemoglobin F Protein | +Inquiry |
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
◆ Cell & Tissue Lysates | ||
PARD6A-3436HCL | Recombinant Human PARD6A 293 Cell Lysate | +Inquiry |
CAMK1-7883HCL | Recombinant Human CAMK1 293 Cell Lysate | +Inquiry |
PPCDC-2982HCL | Recombinant Human PPCDC 293 Cell Lysate | +Inquiry |
TNFAIP2-695HCL | Recombinant Human TNFAIP2 lysate | +Inquiry |
NXNL1-1240HCL | Recombinant Human NXNL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC83.16c Products
Required fields are marked with *
My Review for All SPBC83.16c Products
Required fields are marked with *
0
Inquiry Basket