Recombinant Full Length Schizosaccharomyces Pombe Mitochondrial Intermembrane Space Import And Assembly Protein 40(Mia40) Protein, His-Tagged
Cat.No. : | RFL30831SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Mitochondrial intermembrane space import and assembly protein 40(mia40) Protein (P87059) (62-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (62-313) |
Form : | Lyophilized powder |
AA Sequence : | AASLTAGYLLGKNTSNASSSQDNDHPVVGEHVHTETQSYNEPYMQRHRIEDAIEKKMTSE TQPSTDEKGRKVSATENSAPKKTDKEKSSGETAGNILREQIATGKDDDEYARKFEEVEEE SSEESAFNPDTGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSKSEPKGMECLDKFQAMQ ACFQKHPEIYQDMVGESEEEDAETNEKPSTTSDENNQPQSPPSDNASNPEEDVMNMEKEI VNLTPMSVIKEI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mia40 |
Synonyms | mia40; tim40; SPAC57A10.11c; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40 |
UniProt ID | P87059 |
◆ Native Proteins | ||
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
ALB-293B | Native Bovine ALB Protein, TRITC-labeled | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-470C | Cynomolgus monkey Spleen Lysate | +Inquiry |
PLA2G6-3139HCL | Recombinant Human PLA2G6 293 Cell Lysate | +Inquiry |
DSC2-1159RCL | Recombinant Rat DSC2 cell lysate | +Inquiry |
MEST-4363HCL | Recombinant Human MEST 293 Cell Lysate | +Inquiry |
CALM1-7890HCL | Recombinant Human CALM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mia40 Products
Required fields are marked with *
My Review for All mia40 Products
Required fields are marked with *
0
Inquiry Basket