Recombinant Full Length Schizosaccharomyces Pombe Alkaline Phosphatase (Spbc14F5.13C) Protein, His-Tagged
Cat.No. : | RFL-34594SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Alkaline phosphatase (SPBC14F5.13c) Protein (O60109) (1-532aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-532) |
Form : | Lyophilized powder |
AA Sequence : | MASERDPLLPVHGEGPESPSRRNWKTWIKHGILLILVLSTVIFFYFFSSHKSKGTNEKPK FVIMMVSDGMGPGSLSMTRSFVETLNDKEGYRLPLDEHLIGSSRTRSSSSLITDSAAGAT AFSCANKTYNGAVGVLDNEKPCGTILEAAKEAGYLTGIVVTSRVTDATPASFSAHAANRF MQDLIAEYQVGMGPLGRSVDLLFGGGLCSFLPKSTYRSCRSDNLDLLKYARKKEGFQILL NRTDFDELSNAQLPLLGLFSDYHLSYDIDYQPEVQPKLSEMVETALDVLLNATNEDTSKG FFLLIEGSRIDMASHNNDPIAHVYEVMEYNRAFEIASAFVEKNGGSLISTSDHETGGLTV GRQVSKKYPEYLWKPQVLSLALHSIEYLASAIVNHNQNTLLPYIEQFVLPAIGIPDPNPK QIHDIYVARHNIFNLINVLSDIVSVEAQIGWTTHGHTAVDVNVYGVGEVTEHLRGNMENI EIGQFMEIYLNVSLSDVTEKLKDAPIHGAPDRPSLVETSFSDRLVGFGADLF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC14F5.13c |
Synonyms | SPBC14F5.13c; Alkaline phosphatase |
UniProt ID | O60109 |
◆ Native Proteins | ||
Gliadin-168W | Native Wheat Gliadin | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
Amylase-63P | Active Native Pig Amylase, alpha | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS14-2174HCL | Recombinant Human RPS14 293 Cell Lysate | +Inquiry |
C3orf62-116HCL | Recombinant Human C3orf62 lysate | +Inquiry |
Colon-93H | Human Colon Membrane Lysate | +Inquiry |
IL1R2-1108HCL | Recombinant Human IL1R2 cell lysate | +Inquiry |
HNRNPA1L2-5451HCL | Recombinant Human HNRNPA1L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPBC14F5.13c Products
Required fields are marked with *
My Review for All SPBC14F5.13c Products
Required fields are marked with *
0
Inquiry Basket