Recombinant Full Length Schistosoma Japonicum 25 Kda Integral Membrane Protein Protein, His-Tagged
Cat.No. : | RFL6011SF |
Product Overview : | Recombinant Full Length Schistosoma japonicum 25 kDa integral membrane protein Protein (P91799) (1-224aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schistosoma japonicum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-224) |
Form : | Lyophilized powder |
AA Sequence : | MKLSFTKVSLTNILILFNCLFIIFSMIVLTFGVIPQIYLLKFANILHGVRPSIFPIVCFT GSFVIIVACVGIIGLMKGGKCLLTMHIIALIIATIIDISTATLSAIKQNEFLTKAGQVLN DSSKLYYKNRLYATEFDLMHITFKCCNVKNDYSLLGTLHLIPESCTHGIEFYKQQCNEPL NKYVRYYIDILIYLCFIFGFIKLIYSLFTFTQRQRIFSEKTPVA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Schistosoma japonicum 25 kDa integral membrane protein |
Synonyms | 25 kDa integral membrane protein; Sj25; Sj25/TM4 |
UniProt ID | P91799 |
◆ Native Proteins | ||
CAPN1-186p | Active Native porcine Calpain-1 | +Inquiry |
Laminin-32H | Native Human Laminin protein | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM17-1823HCL | Recombinant Human TRIM17 cell lysate | +Inquiry |
PI3-2035HCL | Recombinant Human PI3 cell lysate | +Inquiry |
ADORA1-9006HCL | Recombinant Human ADORA1 293 Cell Lysate | +Inquiry |
Ovary-846P | Pig Ovary Membrane Lysate, Total Protein | +Inquiry |
KRT18-4877HCL | Recombinant Human KRT18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Schistosoma japonicum 25 kDa integral membrane protein Products
Required fields are marked with *
My Review for All Schistosoma japonicum 25 kDa integral membrane protein Products
Required fields are marked with *
0
Inquiry Basket