Recombinant Full Length Sarcophyton Glaucum Nadh-Ubiquinone Oxidoreductase Chain 3(Nd3) Protein, His-Tagged
Cat.No. : | RFL36421SF |
Product Overview : | Recombinant Full Length Sarcophyton glaucum NADH-ubiquinone oxidoreductase chain 3(ND3) Protein (O63850) (1-117aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sarcophyton glaucum (Toadstool umbrella leather coral) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-117) |
Form : | Lyophilized powder |
AA Sequence : | MEFKGILILLIISGTLSILILGASYILGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFL IGILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWEN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ND3 |
Synonyms | ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3 |
UniProt ID | O63850 |
◆ Recombinant Proteins | ||
Erbb2-2514MAF555 | Recombinant Mouse Erbb2 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
UBFD1-17743M | Recombinant Mouse UBFD1 Protein | +Inquiry |
GAPC1-1413M | Recombinant Mouse-ear cress GAPC1 protein, His&Myc-tagged | +Inquiry |
HBA-7857C | Recombinant Cattle HBA protein, His & T7-tagged | +Inquiry |
NDUFA4-5601C | Recombinant Chicken NDUFA4 | +Inquiry |
◆ Native Proteins | ||
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
IgA-203H | Native Human Immunoglobulin A | +Inquiry |
Lectin-1805L | Active Native Lycopersicon Esculentum Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
Brain-749B | Bovine Brain Membrane Lysate, Total Protein | +Inquiry |
CLMP-2805HCL | Recombinant Human CLMP cell lysate | +Inquiry |
TNK2-715HCL | Recombinant Human TNK2 cell lysate | +Inquiry |
Tobacco-713P | Tobacco Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ND3 Products
Required fields are marked with *
My Review for All ND3 Products
Required fields are marked with *
0
Inquiry Basket