Recombinant Full Length Salmonella Typhimurium Upf0299 Membrane Protein Yohj(Yohj) Protein, His-Tagged
Cat.No. : | RFL7512SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium UPF0299 membrane protein yohJ(yohJ) Protein (P60636) (1-132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-132) |
Form : | Lyophilized powder |
AA Sequence : | MSKSLNIIWQYIRAFVLIYACLYAGIFLASLLPITIPGSIIGMLILFVLLALQILPAKWV NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAISTLVVFVVVSWSSHLIHG ERKVVGQKGTKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yohJ |
Synonyms | yohJ; STM2181; UPF0299 membrane protein YohJ |
UniProt ID | P60636 |
◆ Native Proteins | ||
Hyaluronidase-35O | Active Native Ovine Hyaluronidase, 300U/mg | +Inquiry |
Collagen Type I & III-06M | Native Mouse Collagen Type I and III Protein | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
ALB-313B | Native Bovine Albumin, Texas Red Label | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBLC-001HCL | Recombinant Human CBLC cell lysate | +Inquiry |
Ovary-354C | Cynomolgus monkey Ovary Membrane Lysate | +Inquiry |
CD58-1127HCL | Recombinant Human CD58 cell lysate | +Inquiry |
CCDC58-7758HCL | Recombinant Human CCDC58 293 Cell Lysate | +Inquiry |
FFAR2-6256HCL | Recombinant Human FFAR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yohJ Products
Required fields are marked with *
My Review for All yohJ Products
Required fields are marked with *
0
Inquiry Basket